KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ017652Help
Entry
CpipJ_CPIJ017652  CDS       T01079                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    CpipJ_CPIJ017652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16 C_GCAxxG_C_C
Motif
Other DBs
NCBI-GeneID: 6051660
NCBI-ProteinID: XP_001868061
VectorBase: CPIJ017652
UniProt: B0XEI9
AA seq 579 aa AA seqDB search
MVHFAVWPLLLLPLAALAFNDVFDEELLIKPLPDGFVYSYFQFTTRWQLAGNDSLLHTHL
VSRSLAELFHHYDVSELHLSFTNGIWRYENWGFPVVDAGPGAEVWAWFNGNDDGEVDGRW
KQLCGTLSGLFCASLSFVDGTNTFRPEYSLRPQTHRFGEELRVRYAALPREIVCTENLTP
WKKLLPCKLREGFASLLTPDHVYSGNYHSLALHVRKLCEDAQCGRFQLEVRQSVSLVQDQ
RLFGGKDWSVRKLFGQGMEGACTLAASSKLYVDVTDRSYEMTQVPTDVIRTTRGGASSVL
YEYDIKQFERKQRMFNVAAVDRADPNVISLIQPPPIYSKRFISGVGQERGRIVTRITNTH
WTDLNLIIFENIPWFVPIYLHTLKITQGPIQHTPRTVKYIPGRQRERPSHLEIALTIPKR
STLELSIDFDYIFLKWQEYPPDASHGHYLQPSIISVLLPTARNYTSLPREAALFRDSFNA
TQPEGYFLQLRTEALLLTLPIPDFSMPYNVICLACTVVALAFGPIHNISTKKIVAKSKEP
KDKPKWGQKIRGWFGKGKKKVEDEGEGSGDKTELVEGEK
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggtccacttcgcggtgtggccactgcttttgctgccactggcagcgctcgccttcaac
gacgtcttcgacgaggaactcctgatcaaacccctgccggacggcttcgtgtacagctac
ttccagttcacgacccgctggcagctcgccggaaacgacagccttcttcacacccacctg
gtgtcccgttcgctggccgagctgttccaccactacgacgtgagcgagctgcacctgagc
ttcacgaacggcatctggcgctacgagaactggggctttccggtggtggatgccggtccc
ggggccgaggtgtgggcctggttcaacgggaatgacgacggtgaggtggatgggcggtgg
aagcagctgtgcgggacgctgtcggggttgttttgcgcctcgttgagcttcgtggacggg
acgaacaccttccggccggagtactcgttgaggccgcaaacgcaccggtttggggaggag
ttgagggtgcggtacgcggcgttgccgcgggagattgtctgcacggagaatctgacgccg
tggaagaagctgctgccgtgcaagttgagggagggttttgcgtcgctgctgacgccggac
catgtgtattccgggaattatcactcgctggcgttgcacgtgcggaagttgtgcgaggac
gcgcagtgcggtcggttccagctggaggtgaggcagagtgtcagcttggtgcaggaccag
cgcctgtttggagggaaggattggtccgtgcggaagctgtttggccaggggatggagggg
gcctgcacgttggctgccagcagcaagctgtacgtggacgttacggatcgtagctacgaa
atgacccaggttccgactgacgtgattcgaacgacacggggcggggccagttccgtgctg
tacgagtacgacatcaagcagttcgagcggaagcaacggatgttcaacgtggccgccgtt
gaccgggctgacccgaacgtcatttcactgatccaacctcctccgatctactccaagcgg
ttcatctccggcgtgggtcaggaacgtggccgcatcgtaacacgcatcaccaacacccat
tggaccgacctcaacctgatcatcttcgaaaacattccctggttcgtgccgatctacctg
cacacgctgaagatcacccaaggccccatccagcataccccacgaaccgttaagtacatt
ccaggccgccaacgggaacgcccctcccacctggaaatcgccctcaccattccaaagcgc
tccaccctggagctctccatcgacttcgactacatcttcctcaagtggcaagagtacccg
ccggacgccagccacggccactacctccaaccctccatcatctccgttctcctcccaacg
gcccgcaactacacctcgctcccccgtgaagccgccctcttccgggactcgttcaacgcg
acccaacccgagggctacttcctccagctgcgaaccgaagccctgctcctgaccctgcca
atccccgactttagcatgccgtacaacgtgatctgcctggcctgtaccgtggtggcgctt
gccttcggaccgattcacaacatctcgaccaagaagattgtggccaagagcaaggagccg
aaggacaagcccaagtggggccagaagattcggggctggttcgggaaggggaagaagaag
gtggaggatgagggggaaggaagcggggacaagactgagctggtggagggggagaagtag

DBGET integrated database retrieval system