KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ017833
Entry
CpipJ_CPIJ017833  CDS       T01079                                 
Name
(GenBank) isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00900  Terpenoid backbone biosynthesis
cqu01100  Metabolic pathways
Module
cqu_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CpipJ_CPIJ017833
Enzymes [BR:cqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     CpipJ_CPIJ017833
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-ProteinID: EDS26879
VectorBase: CPIJ017833
UniProt: B0XFL6
AA seq 249 aa
MSTLLARFRGFLPSAAAAALQRQPLRFGSATAAAKLQELALEENCILVDESDRVLGNASK
RDCHRVDPDGNIRLHRAFSVFLFNSRGEMLLQRRSTHKITFPDCYTNACCSHPLHDIEGE
REELNALGIRRAAQRRLNYELGIPLSQVRPENFHFLTRIHYADRGDGVWGEHEIDYILFL
QKDVDLKPNEGEVSEIRYIARNELDQQIASLEAPLTPWFRLILAHRLPLWWDNLHRLKKH
VNLGEIERF
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtcaacgctgctggctcgcttccgcgggttcctgccctctgcggcagcggcagccctt
caacggcaacctctccgtttcggaagtgccacggcggcggccaagctgcaggagctggcc
ctcgaggagaactgcatcctggtggacgagtcggaccgtgtgctgggaaacgcctccaag
cgggactgccaccgggtcgatccggacgggaacatccggctgcatcgggccttcagcgtg
ttcctgttcaattcgcggggcgagatgctgctgcagcgacggtccacgcacaagataacc
tttccggattgttacacgaacgcgtgctgcagccacccgctgcatgacatcgagggcgag
agggaggaattgaacgcgctcggcatacggcgagcggcccagcgccggctcaactatgag
ctcggcattccacttagccaggtccgcccggagaacttccacttcctgacgcggatccac
tacgccgaccggggcgacggcgtgtggggcgaacacgagattgactacattctgttcctg
cagaaggacgtcgacctgaagccgaacgagggcgaggtcagcgagatccgctacatcgcg
cggaacgagctggaccagcagatcgcctcgctggaggcccccctcacaccgtggttccgg
ctcattctggcccaccggctgccactctggtgggacaacctgcaccggctgaagaagcac
gtgaatctcggcgaaattgaacgattctaa

DBGET integrated database retrieval system