KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018289
Entry
CpipJ_CPIJ018289  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    CpipJ_CPIJ018289
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CpipJ_CPIJ018289
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     CpipJ_CPIJ018289
SSDB
Motif
Pfam: NAD_binding_4 Sterile 3Beta_HSD Epimerase Polysacc_synt_2 Semialdhyde_dh GDP_Man_Dehyd RmlD_sub_bind KR
Other DBs
NCBI-ProteinID: EDS26914
VectorBase: CPIJ018289
UniProt: B0XFN3
AA seq 564 aa
MTVASLQQEVLNQSAPSAPETELPASPSAGGGGGGGGGGGSSTSGATPLVVPTAEPIVID
SPAAVDLKLTEIQQFYDRCNVFITGGTGFLGKTLIYKLLTSCPGVENIFLLIRSKRGKDI
FSRVEEIFEDAMFNKMKQACPKYDHKIRAIAGDCTLPSLGIGSSDRETLVENVNIVFHLA
ATVRFDEKMKTAMQINVKACRDILDLCYEMKHLKSVIYVSTAYTQCPQKEVEERFYEPPL
DSKKMIALTDCVSDSMMENITPILLDKWPNTYTFTKAIAEDVVRQNSRGMPIGMFRPGIV
IATYQEPVPGWIDNFYGPTGVIAGAGTGVLRTLRADPTKVANMVPVDLCVNGMISAAWDI
AERFQTEIMPDPEIPVYNFCTERSNCITWGDFTYTTIKFGSMYPTVKSVWYLCYRSNPNR
IMHFLAILFLHYLPAIFFDVIALFIGRKPRLMRTYKKIHRFMAVIEYFSMRQWDFKMENM
NALWRRLSNADQKLFFFDMRQINWDFFLEQYFCGIRQYLLRDPLETVPEALVRWNRLYWL
HQAVKVLVLFVMYKLVFSIWGFLS
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgaccgtagcgtccctgcagcaagaggtgctgaaccagtcggcgccgtccgccccggag
acggaacttccggccagccccagtgccggcggaggtggtggtggcggcggcggcggtggc
agcagcacctctggcgccaccccgctggtggtgcccacggcggagcccatcgtcatcgac
agtccggccgcggtcgacctgaagctgaccgagattcagcagttttacgaccggtgcaac
gtgttcataacgggcggaaccggatttttgggcaaaactctcatatacaaactgctgacc
agctgtccgggcgtggaaaacatattcctgctgatccggagtaaacgcggaaaggacatc
ttttcccgcgtcgaggaaatcttcgaagatgccatgttcaacaaaatgaagcaagcctgc
ccaaagtacgaccacaaaatccgagccatcgccggagactgcacacttccgagcctcggt
atcggttcctccgatcgggaaaccctggtggaaaatgtcaacatcgtgttccacctggcc
gcgacggtgcggttcgacgagaagatgaagacggccatgcagatcaacgtcaaagcctgc
cgggacattctggacctgtgctacgaaatgaaacacctcaagtcggtcatctacgtgtcc
accgcgtacacccagtgcccgcagaaggaggtggaagagcggttctacgagccgccgctg
gactccaaaaagatgatcgccctgacggactgcgtcagcgactccatgatggagaacatc
acgccaatcttgctggacaagtggccaaatacctacacattcaccaaggcgatcgccgag
gacgtggtccggcagaacagcaggggcatgccgattggcatgtttcggccgggtattgtg
atagccacataccaggagccggtgcccggatggatcgacaacttctacggacccacgggt
gtgatcgccggggcgggaaccggagtgctgcgaacactgcgcgccgacccgaccaaggtg
gccaacatggtgccggtggatctgtgcgtcaacggcatgatctcggcggcctgggacatt
gccgagcggttccaaaccgaaatcatgcccgacccggagattcccgtgtacaacttctgc
accgagcgtagcaactgcatcacctggggcgatttcacctacaccacgatcaagtttggc
tccatgtatcccacagtcaagtcggtttggtacctgtgctaccgaagcaatccgaaccgg
ataatgcacttcctggcgatactgttcctgcactacctgcccgcgatattcttcgacgta
atcgcgctgttcatcggacgtaaacccaggctcatgcgcacgtacaagaagattcaccgc
ttcatggccgtgatcgagtacttctcgatgcgccagtgggactttaagatggagaacatg
aacgcgctgtggcggcggctctcgaacgccgaccagaagctgttcttcttcgacatgcgc
cagatcaactgggacttcttcctggagcagtacttctgcggcatccggcagtacctgctg
cgcgacccgctcgaaaccgtcccggaagctctcgtacgatggaatcgtctatactggctg
caccaagcagtcaaggtacttgtgctgtttgtgatgtacaagctggtcttttcgatttgg
ggcttcctgagttaa

DBGET integrated database retrieval system