KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ019024Help
Entry
CpipJ_CPIJ019024  CDS       T01079                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04214  Apoptosis - fly
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ019024
   04215 Apoptosis - multiple species
    CpipJ_CPIJ019024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 6053051
NCBI-ProteinID: XP_001869210
VectorBase: CPIJ019024
UniProt: B0XHT8
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCSQCHTVEAGGKHKVGPNLHGLMGRKTGQAAGFSYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPGERADLIAYLKSATA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttcctgccggagatgttgagaagggcaagaagctgtttgtccagcgttgctcg
cagtgccacaccgtcgaggccggtggcaagcacaaggtcggcccgaacctgcacggtctg
atgggccgcaagactggccaggctgccggattctcctacaccgacgccaacaaggccaag
ggtatcacgtggaacgaggacaccctgttcgagtacctggaaaaccccaagaagtacatc
cccggaaccaagatgatcttcgccggtctgaagaagcccggagagcgcgccgatctgatc
gcgtacctcaagtcggccaccgcctaa

DBGET integrated database retrieval system