KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ019272Help
Entry
CpipJ_CPIJ019272  CDS       T01079                                 

Definition
(RefSeq) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00270  Cysteine and methionine metabolism
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CpipJ_CPIJ019272
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     CpipJ_CPIJ019272
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     CpipJ_CPIJ019272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 Cupin_3
Motif
Other DBs
NCBI-GeneID: 6054106
NCBI-ProteinID: XP_001870076
VectorBase: CPIJ019272
UniProt: B0XKA4
AA seq 183 aa AA seqDB search
MVRAWFMDNEDTDQRLEHHLNPPEFLTLDQLFTSTGVEYFKINVPTFDSDGVLEGIRKKR
GYSYEDEITCSKDCLPDYENKLKSFFTEHLHTDEEIRFVVDGSGYFDVRNGKDDRWVRIE
VVAGDMIVIPSGIYHRFTLDNKNYIKAKRYFVGEPVWLPYNRPADDMEARKDYLHRLETG
FAA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtgcttggtttatggacaacgaggacaccgaccagcggctggagcaccacctg
aacccgccggaatttctcaccctggaccagttgttcaccagcaccggtgtcgaatacttc
aagattaacgttccgaccttcgacagcgatggtgtcctcgagggaatccgcaagaagcgc
ggttacagctacgaggacgaaatcacctgctccaaggactgtctgccggactacgagaac
aagctgaagagcttcttcacggaacatctgcacacggacgaggagattcggttcgtggtg
gacggctccggatactttgacgtgcgcaacggtaaggacgaccgctgggtgcggatcgag
gtcgtggcgggagatatgattgtgattccgtccgggatctaccatcggttcacgctggac
aacaagaattatattaaggccaagcgatatttcgtcggggagccagtttggctgccttat
aatcggccagcggacgatatggaggcaaggaaggattatctgcaccggctggagacggga
tttgccgcgtag

DBGET integrated database retrieval system