KEGG   Chlamydia trachomatis A2497: CTO_0695Help
Entry
CTO_0695          CDS       T02094                                 

Definition
(GenBank) Exodeoxyribonuclease V gamma chain
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
cra  Chlamydia trachomatis A2497
Pathway
cra03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cra00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CTO_0695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cra03400]
    CTO_0695
Enzymes [BR:cra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CTO_0695
DNA repair and recombination proteins [BR:cra03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CTO_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AEP35517
UniProt: G4NN19
Position
complement(733487..736570)
Genome map
AA seq 1027 aa AA seqDB search
MCNDQCTERSFPRNNTHECKPMNELSHSQATFSNYPEVLLAKLAQDLFSINQTPMTKRWI
LVPSSDTDHWLRRELVKASSNHIFMGTHIFASFDAFVKYLFTGTRLVDLSTPDHITLPLT
IYNLLKESSFNSSSEVSYSHLQKLSSIFKKFYTFSQEPSTNNPYYKNLFAQLKDSYTPLE
TIFSSILDHPLEYPCSLHIFGYPQLPQHVASFFVALGKYFPVHFYCFSPSAAYFGDLLSD
KAMAALSPRIPEPQQETWEKYVLTDRLALLANLAHKSQSLQNFFLDCSVPYEELFQPYEK
LSSLHIVKDSFFHLQPIDQKLFSNSPQTIFVRQAPSASREVHQLFSLVSQLLHSGVPAQE
IFILSSNLSKYETLLRGIFEPHLPLYLTKTEKTQTRTLKNKLLLVVTFLFSKGSLNDLLR
ILSHPDLLSPLETTKMGFLTHKLTHYWKSLSQKDSPLTQLIHRILDEYPFIDDTGSVNEA
ETWEVVVPLLHTLQQVTASYIESKDKTYEEHSRLIFSALENIFFLSTEEHALLVSLSKTL
QPFVRSSCSLTIFIEFCLDFLSHIPGHSQLYNQPGPFIGSLNSLSLIPKGYTFILGANKK
DHSLDTSFLIDPSLIQEDFLFSSTEDEDNLHFLQTIVSTKHQLHISYLSSSKNPALPSSA
LKHLLDAVPIQEEHLSGKLYAKKNFSSEPLHQSYQVYYRMAQVSPLQNKAPSLFKSDTTK
TLPSHLSLQHLIKAFKDPLNFFLSTQHGFSFHPKALFSKSEKVFPSPHDAKAFWNHLLSS
KTPLPTTNYLSAFTESLYTDVQDSVSKRLETLQKDPATTPFSVVFSDQLFHDPLHPNDQQ
VSPLLLSLPLKNIHLQGTIHGVCSKGVYLFSMHPGEAFKKTQKTHGFPKDAFELESYLES
YLSLALLQASHLLPKEATILRVTPHDIEPILPPFSSPESYLIRAIHLYELLQNQAIPLPS
AQAWEYIKKTDSASQCIKKLLDSEEDPLTSSFWWFHNRDTEEICSRLSNDVLSQLLSLFI
NQDSQQN
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacgaccaatgcacggaaagatcgtttcctcgcaataatacccatgaatgtaaa
ccgatgaatgaactatctcacagccaagcaacgtttagcaactatcccgaagtcttgctg
gctaaacttgctcaagatctgttctctatcaaccaaactcccatgacaaaacgatggatt
ctggtgccgagctcagacacagatcactggctacgaagagaattggtaaaggcttcatcc
aatcacatcttcatggggacacatatttttgcctcttttgacgcttttgtcaaatactta
tttacggggacgcgtctcgtcgacctctctacccccgatcacattaccctccctctaacc
atttataacctgttaaaagaatcttctttcaactcttcttccgaggtttcttattcccat
ctacaaaaactttcttctattttcaaaaagttttacacgttttctcaggagccttcgacc
aacaatccttactacaaaaatttatttgcacaacttaaagactcctatactccattagaa
accattttttcttcgattctggatcatcctctggaatatccttgttctctgcatattttt
gggtatccacaacttccccaacatgtagcctccttctttgttgctttaggaaaatatttc
cctgtgcacttttactgtttttctcctagtgcagcctatttcggggatcttttgtctgat
aaagcgatggcagcactttccccgagaatcccagaaccgcagcaagaaacctgggagaaa
tatgtattaacggatcggttagcattacttgctaaccttgctcacaaatcgcaatcacta
caaaacttttttttagattgtagcgttccctatgaagaactgtttcaaccctacgaaaaa
ctttcttctttacacattgtaaaagacagttttttccatttacaacctatagaccaaaag
ctgttctctaattcaccacaaactatttttgtacgacaagctccttccgcatcccgagaa
gtccatcaattattttcgcttgtttctcagcttctccattctggagttcctgctcaggaa
atctttattctctcttctaatctttctaaatacgaaaccttgttaagagggatctttgaa
cctcatcttcctttatatttaacaaaaactgagaagacacaaacccgcacactaaaaaac
aagctcttgttagtagtgacctttctattctctaaaggctctctgaacgacctacttcgt
atcctttctcatcctgatcttctctcccccttagagactacaaaaatgggcttccttacc
cataaacttacgcactattggaaatccttatcacaaaaagactctcctcttactcaactc
atccatcgtattttggatgaatatccgtttattgatgatactggtagcgttaatgaagct
gagacatgggaagttgtcgttcctcttcttcacacactacaacaagtcacagccagttac
atagaatctaaagataaaacctacgaagagcactctcgtcttatcttttctgctttagaa
aatattttcttcctctctacagaagagcatgctttgttggtttctttatcaaaaacacta
caaccctttgtacgctcttcttgctctttaaccattttcattgagttttgcttagacttc
ctctcacacattcctggtcatagccaactatacaatcaacctgggccctttatagggtcc
ttaaatagtctcagtttaattcctaaagggtatacttttattcttggagcaaacaaaaaa
gatcactcactcgataccagttttcttattgatccttctctcattcaggaagattttcta
ttttcctccactgaagatgaggataacttacattttctacagactatcgtttctacaaaa
caccagctccatattagttatctctcttcatccaagaatccagcattaccgagctccgct
ttgaaacatttgttggatgctgtgcctattcaagaagaacatctttctgggaaactctat
gctaaaaaaaacttttcttctgaaccgttgcatcagtcttaccaggtttactaccggatg
gctcaagtctccccgctacaaaacaaggccccatccctgtttaagtctgatacaactaag
acgttaccttcacatctatccctacaacatctaatcaaagctttcaaagatcctttaaac
tttttcctaagcacgcaacatggcttttcctttcatcccaaggcactattttctaaatca
gaaaaagtctttcctagtcctcacgatgctaaagctttttggaaccaccttctctcttct
aaaactcctctacccactactaattatctttcagcctttacagaatctctatacaccgat
gtacaagactccgtaagtaaacgcttagaaactttgcagaaagatcctgctacaactccc
ttttctgttgtattttccgatcaactttttcacgacccactccatcctaatgatcaacaa
gtctctcccctactcctatctctccccctaaaaaatattcatcttcaagggacgattcat
ggcgtatgttcaaaaggggtatatctattttctatgcatccgggagaagcctttaagaaa
actcagaaaactcatggattccctaaagatgcctttgaactagaatcttatttagaatcc
tacctatccttagcgttactacaagcctctcatctacttcctaaagaagctaccatcctc
cgcgttacacctcatgacattgagcctatccttcctcctttttcctccccagaatcctac
ttgatccgcgcgatccacctgtatgagctcttacaaaatcaagcaattcctcttccttct
gctcaagcctgggaatacattaaaaaaactgattcagcgtcacagtgtataaaaaaactt
ttagatagcgaagaagaccccctaacaagtagtttttggtggttccataatcgtgataca
gaagaaatctgctcaagactctctaatgacgtgctctcgcagcttctttctctctttata
aatcaagatagtcaacaaaactga

DBGET integrated database retrieval system