KEGG   Chlamydia trachomatis A2497: CTO_0784Help
Entry
CTO_0784          CDS       T02094                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cra  Chlamydia trachomatis A2497
Pathway
cra00010  Glycolysis / Gluconeogenesis
cra00260  Glycine, serine and threonine metabolism
cra00680  Methane metabolism
cra01100  Metabolic pathways
cra01110  Biosynthesis of secondary metabolites
cra01120  Microbial metabolism in diverse environments
cra01130  Biosynthesis of antibiotics
cra01200  Carbon metabolism
cra01230  Biosynthesis of amino acids
Module
cra_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTO_0784
  Energy metabolism
   00680 Methane metabolism
    CTO_0784
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTO_0784
Enzymes [BR:cra01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTO_0784
Membrane trafficking [BR:cra04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CTO_0784
Exosome [BR:cra04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTO_0784
  Exosomal proteins of melanoma cells
   CTO_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEP35611
UniProt: G4NNR6
Position
complement(836460..837149)
Genome map
AA seq 229 aa AA seqDB search
MLSMTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLV
RSLITALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQG
KNKQEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFIS
AHGNSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgctctctatgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaa
aatctgtttacaggctgggtagacatccctcttagccaacaaggaattcaagaggctatt
gccgctggagaatctattaaacatcttcctattgattgcatcttcacttccaccttggtt
agaagtttgataacagccctgttagcaatgactaaccacagctctcaaaaagttccttat
atcgttcatgaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcag
atgatccctctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaagga
aaaaataaacaagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccga
agctaccgcattgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctc
ccctattttcaagagagaattttccctctccttcagcaagggaaaaatatttttatctct
gctcacgggaattctttgcgctccttaattatggacctagaaaaattatctgaagaacaa
gtactctctttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaa
ttcacgaaacacgctccttctcttggttaa

DBGET integrated database retrieval system