KEGG   Chlamydia trachomatis A2497: CTO_0847Help
Entry
CTO_0847          CDS       T02094                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cra  Chlamydia trachomatis A2497
Pathway
cra00780  Biotin metabolism
cra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CTO_0847
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cra01007]
    CTO_0847
Enzymes [BR:cra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CTO_0847
Amino acid related enzymes [BR:cra01007]
 Aminotransferase (transaminase)
  Class II
   CTO_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEP35668
UniProt: G4NPJ5
Position
913976..915109
Genome map
AA seq 377 aa AA seqDB search
MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDG
VEHQIAHFHGAPEALILPSGFVANTAICAHLSSVADYVLWDEQVHISVSYNLSVFLSGWH
QSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSFALLEQIVALSHQYHAQLIVD
EAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSRDRKQDLIKEPMVSL
STGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQ
ELYQKLVATGIRVGVACPPTGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGST
STMQRTLEDNFAAANAS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaagctctttctattgattttatcactaatgatttcctgggattctctcgttca
gatagcttagttcatgctgttgaggctcgttatcggctttattgtagagacaagcctcat
gcgcagttaggttatggaggttcgcgcgctattttaggctcttcctcgctgttagatggg
gtagagcatcaaatagcgcactttcatggagctccagaagctcttattttgccaagtggt
tttgttgcgaatactgcgatttgtgcgcatctatcttccgtagcggattatgtgctatgg
gacgagcaggtgcatatctccgtttcttacaatctatctgtttttttgtcggggtggcat
cagagtttccgccataatgatttagatcatctagagtctttattagagtcttgtcagcaa
cgtggttttcaacgagtatttatcctcgtctgttctgtttattcttttaaggggtctttt
gctcttttggagcaaatagtggcattgtctcatcagtatcacgctcagttgatagttgat
gaagcgcatgctgtgggattatttggagacgctgggaagggattttgtgcctcgttaggg
tatgaaaatttctattctgtactcgttaccttcagtaaagctttgggatccgcgggtgca
gcttggttatcttctcgcgataggaagcaggatttgatcaaagaacctatggtaagtctt
tctacaggaatacctccctatttgttagtatctatacaagttgcatacgaatttctctca
caagaaggagaacttgcgagaacacgattacgtcgtattcgtgactattttgctcaaaaa
atctcttgggcagcagctggatttgtgcaaccgctctctctccctgggatctctgagcag
gaattgtatcaaaaattagttgccacaggcattcgtgttggagtcgcttgtcctcctaca
ggtaaagtactgcgagccaatttacatgctttcaataccgaacaagaagtagatattttg
gtttcgttgcttgccacggagcaagtaacgtatcagaagaatgtcgtaacaggatctaca
tcaacaatgcaacgcactttagaggacaattttgcagcggctaatgcctcttga

DBGET integrated database retrieval system