KEGG   Capsella rubella: 17874700Help
Entry
17874700          CDS       T02984                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP15-2
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
crb  Capsella rubella
Brite
KEGG Orthology (KO) [BR:crb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:crb03110]
    17874700
Enzymes [BR:crb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     17874700
Chaperones and folding catalysts [BR:crb03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    17874700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 17874700
NCBI-ProteinID: XP_006279706
UniProt: R0G7W8
Position
Unknown
AA seq 164 aa AA seqDB search
MASKMCLRYSLFLILFSLISFQGFSKKTGDVSELQIGVKFKPKTCDVRAHKGDRIKVHYR
GKLTDGTVFDSSFERGDPFEFELGSGQVIKGWDQGLLGACVGEKRKLKIPAKLGYGEHGS
PPTIPGGATLIFDTELMAINEKPAGGEEDGGDEEGEGDGDDDEL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaagatgtgtctccgttactccctctttttgatcctcttctctctcatttca
ttccaaggtttttctaagaagacgggagacgtgtctgaattgcagatcggggttaagttt
aagccaaaaacgtgtgacgttcgggctcacaaaggtgataggatcaaggtgcattacagg
gggaaacttactgatggaactgtattcgattcgagttttgaaaggggcgatccgtttgag
tttgagttaggaagtggtcaagttattaaaggttgggatcaaggtttgctaggagcgtgt
gtaggtgagaagcggaagttaaagatacccgcgaaacttggatatggagaacatggctct
ccgcctactatccccggtggtgcaacactgatattcgacacagagcttatggcgataaat
gaaaaaccagctggtggagaagaagatggaggagatgaagaaggagagggagatggtgac
gacgacgagctatga

DBGET integrated database retrieval system