KEGG   Capsella rubella: 17876741Help
Entry
17876741          CDS       T02984                                 

Definition
(RefSeq) methionine S-methyltransferase
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
crb  Capsella rubella
Pathway
crb00450  Selenocompound metabolism
crb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    17876741
Enzymes [BR:crb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     17876741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 MTS PrmA Methyltransf_31 Methyltransf_25 Met_10 Methyltransf_12 Methyltransf_23 Methyltransf_11 Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 17876741
NCBI-ProteinID: XP_006281941
UniProt: R0GDP6
Position
Unknown
AA seq 1069 aa AA seqDB search
MADLSVDDFLNQCKQSGDAAYGALRSVLERLEDPNTRSKARIFLSDIYKRVGSSETSLQT
YHFHIQDIFLDQYEGFQSRKKLTQMVIPSIFIPEDWSFTFYEGLNRHPDTIFKDKTIAEL
GCGNGWISIAIAAKWLPSKVYGLDINPRAVKISWINLYLNALDDNGEPVYDDEKKTLLDR
VEFYESDLLGYCRDNNIQLERIVGCIPQILNPNPEAMSKLITENASEEFLHSLSNYCALQ
GFVEDQFGLGLIARAVEEGISVIKPAGIMIFNMGGRPGQGVCRRLFERRGVRVTQMWQTK
ILQAADTDISALVEIERSSPHRFEFFMGLSGDQPICARTAWAYGKAGGRISHALSVYSCQ
LRQPNQVKIIFDFLKNGFQEISNSLDLSFEDEAVADEKIPFLAYLASVLKNSSYFSFEPP
AGSRRFCSLIAGFMRTYHRIPINQDNVVVFPSRAVAIESAFRLFSPQLAIVDEHLTRQLP
RSWLTSLAVENTSTEKSDDQITVIESPHQSDLMIELIKKLKPQVVVTGMAPFEVITSSSF
LHLLDVTREIGCRLFLDISDHFELSSLPASNGVLKYLAENQLPSHAAIICGLVKNKVYSD
LEVAFVISEVDVISKALSKTVEVLEGHTAIISQYYYGCLFHELLAFQLADRHAPAERESE
KAKSEEIIGFSSSAVSVLKDAELSVTEIDDTSLIHMDVDQSFLPIPRSVKAAIFESFVRQ
NISEAEVDINPSIKQFVWSNYGFPTKSSTGFVYADGSLALFNKLVSCCAQEGGTLCLPAG
TNGNYVAAAKFLKANVVNIPTESSDGFKLTEMTLVKALESVKKPWVCISGPTVSPTGLVY
SNEEMDILLSTCAKFGAKVIIDTSFSGLEYSATSWDLKDTLSRLDSSLSVSLLGCLSLNL
LSGALKLGYLVLDQSLIDAFHTLPGLSKPHSTVKYAAKKMMALKEEKAGDFMDAVSETIK
TLEARSKRLKEVLENSGWEVIAPSAGISMVAKPKAYLDKTVKVKAGDGQEVKLTDSNIRD
VFLSHTGVCLNSGSWTGIPGYCRFSFALEDSEFDKAIESIAQFKSVLAN
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctctccgtcgacgacttcctcaaccagtgcaaacaatccggcgacgcagct
tatggcgccttgcgatcggtgctggagcggctcgaggatccaaatactcgatctaaggct
cggatcttcttgtctgacatctacaaacgcgtcggatcctccgagacgtctcttcaaacc
taccatttccatatccaggacatcttccttgatcaatacgaaggctttcagtccaggaaa
aagttaacccagatggtcattcctagtatttttattccagaagactggtcattcacattt
tatgaaggacttaatagacatcctgataccatcttcaaggataagactattgctgaactt
ggatgtgggaatggatggatatccatagccatagctgctaagtggttgccttcaaaggta
tatgggcttgacattaatcctagagctgtgaaaatttcttggataaatttgtacctaaat
gctcttgatgataatggcgaaccagtctatgatgacgagaagaaaactttattggacaga
gtggaattctatgaatctgatttgcttggctattgtagagataataatattcagcttgag
agaattgtaggatgcatacctcagattcttaatccaaacccagaagcaatgtctaagctg
ataacagaaaatgcaagtgaggaatttctccattcgctgagtaactattgtgcccttcag
ggttttgtggaagatcagtttggcttaggtttgattgccagagcggttgaagagggaata
tctgtcatcaaacctgcagggattatgatattcaacatgggtggtcgtcctgggcaaggt
gtctgtagacgcttgtttgagcggcgaggagtccgtgttacacagatgtggcagacaaaa
atacttcaggctgcagatactgatatctcagcattagttgaaattgagaggagcagccct
catcgttttgagttttttatgggactttctggagaccaaccaatttgtgctcgaaccgca
tgggcatatggaaaggctggtggaagaatctcccatgctttatctgtttatagctgtcag
cttcgccaaccaaatcaagttaagataatctttgacttcttgaaaaatggatttcaagaa
atcagtaattcactggatttatctttcgaggatgaagctgttgctgatgagaaaattcca
ttcctagcctatcttgctagtgtcttgaaaaatagctcctatttctcgtttgaaccgccg
gctggcagcagaagattctgcagtctaattgcaggctttatgaggacataccaccgtatt
ccaattaatcaggataacgttgttgtgtttccatcaagggctgtggcaatcgagagtgca
tttcggttattctcccctcaacttgcaattgttgatgagcatttaactcgacaacttccg
aggagctggctaacctctttagctgttgagaacactagcacggagaaatcagatgatcaa
atcacagtcattgaatccccacaccagtccgatctgatgatagaactcattaagaaacta
aagccacaggtggtagttactggaatggctccatttgaggtcattactagttcatctttt
ttgcacctgttggatgtgacgagagaaattggatgtcgacttttcttggatatatctgat
cactttgagttgtctagcctccctgcatccaatggggtactaaaatatctcgcagaaaat
caactaccttctcatgctgcaattatttgcggtctggtaaagaataaggtctattcagat
ttagaagtagcatttgttatttcagaagtggatgtcatttctaaggccttgtccaaaact
gtggaagtcttagaaggtcatacggctattatcagtcaatactactatggttgccttttc
catgagcttttggctttccagcttgctgaccgtcatgcccccgctgagagagaaagtgag
aaggcaaagtctgaagagatcattggattttcaagctcagctgtctctgttctgaaagat
gctgagctttcagtcactgagattgacgacacttctctaatccacatggatgtggatcaa
agtttcttgccaattccacgatctgttaaggctgcaatctttgaaagttttgtgaggcag
aacatatctgaagcagaagttgatataaatccaagtattaagcagtttgtgtggagcaat
tatgggtttccaacaaaaagcagcacaggctttgtatatgctgatggctcccttgcacta
ttcaataaactggtcagttgctgtgctcaagaaggtggaacactctgtttacctgctggc
acaaatgggaattatgttgctgctgcaaaatttttaaaagctaatgttgtgaatatccct
accgagtctagtgatggctttaagctgacggaaatgactctagtgaaagcactcgagtct
gtgaagaagccgtgggtttgtatatctggaccaacggttagccctacaggcttggtgtac
agtaatgaggagatggatatattgttgtctacttgtgctaagtttggagcaaaggtcatc
attgatacttctttctccggattagaatacagtgcaactagctgggatttgaaggacact
ttgtcgagattggattcatccttgtcagtttcgcttcttggatgtctctctttgaattta
ctcagtggagctctgaaactcgggtatctggttttggatcagtctctcattgatgccttc
cataccctcccaggcctgagcaaaccacacagcactgtgaaatatgctgctaagaaaatg
atggctctgaaagaagagaaggcgggtgattttatggatgccgtttctgaaaccattaaa
acgttggaggcgagatctaaacgcttaaaagaggtgctagagaactctggttgggaggtt
atcgcaccctcggcaggaatctcaatggtggcaaagccgaaagcttatcttgacaaaaca
gtaaaggtgaaagcaggagacggacaggaagtcaagcttaccgattcaaatataagggat
gtgttcctcagtcatactggtgtttgcttgaacagcggttcctggaccggaatacctggt
tactgccgcttttcatttgcattggaggatagtgagtttgacaaggctattgaatcaata
gctcagtttaaaagcgtgcttgctaattga

DBGET integrated database retrieval system