KEGG   Capsella rubella: 17877103Help
Entry
17877103          CDS       T02984                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
crb  Capsella rubella
Pathway
crb00511  Other glycan degradation
crb00600  Sphingolipid metabolism
crb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    17877103
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    17877103
Enzymes [BR:crb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     17877103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N EF-hand_5
Motif
Other DBs
NCBI-GeneID: 17877103
NCBI-ProteinID: XP_006279960
UniProt: R0GNT0
Position
Unknown
AA seq 954 aa AA seqDB search
MFEEKIMDSAEDDKSWNPSDTKVDPAVPSSLTWQRKINSDGKAPREFNLTPKEIFQLAPV
GIRLWFLCREEAAKGRFAAIDPFCKHTVTSSHGVPLGGIGAGSIGRSFKGEFQRWQLFPP
KCEDEPVLANQFSAFVSRANGKKYSSVLCPKNPKLGKQESESGIGSWDWNLKGDKSTYHA
LYPKSWTMYEGEPDPELRIVCRQVSPFIPHNYKESSFPVSVFTFTLHNLGNTTADVTLLF
TWANSVGGDSEFSGGHYNSKIMMKDGVQGVLLHHKTANELPSLSYAISAQSTDGVNVSAC
PFFIVSGKQNGTTAKDMWQVIKENGSFDHFEASEASMQSEHGSSIGAAVAASATVPPGES
RIVTFSLAWDCPEVQFPSGKIYSRRYTKFYGTDGDAAAQIAYDAILQHSQWESWIEAWQR
PILEDKRLPEWYPITLFNELYYLNSGGTLWTDGSSPVHSLAGVREKKFSLDKSQLGLKND
IDVPRQNDTAISVLEKMASTLEQLHASTASNSAFGTKLLEEGEENIGHFLYLEGIEYRMW
NTYDVHFYASFALVMLFPKLELSIQRDFAAAVMLHDPTKVKTLSEGQWVQRKVLGAVPHD
LGINDPWFEVNGYNLHNTDRWKDLNPKFVLQVYRDVVATGDKKFAVAVWPSVYVAMAYMA
QFDKDGDGMIENEGFPDQTYDTWSASGVSAYCGGLWVAALQAASALAHVVGDKNSQDYFW
SKFQKAKVVYEKKLWNGSYFNYDTSGSQYSSSIQADQLAGQWYARASGLFPIVDEDKART
ALEKVYNFNVMKIKDGKRGAVNGMHPNGKVDTASMQSREIWSGVTYALSATMIQEGLVEM
AFQTASGVYEAAWSETGLGYSFQTPEAWNTNDEYRSLTYMRPLGIWAMQWALTKTSKEQK
QIGLEPEQEPEASSLMKHDMGFSRVSRLLNLPNEASAKGTLQTLFAYTCRRFMS
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaggaaaagatcatggatagtgctgaagatgacaaatcttggaacccttctgat
actaaagttgatcctgcagtaccttcatctttgacatggcaaagaaagataaacagtgac
ggcaaggctccccgggaattcaatctgactcctaaagagatttttcagctggctcctgtc
gggattcgattatggtttctttgcagagaagaagctgctaaaggaaggtttgctgccata
gatccattctgcaagcacactgtaacgtcttcccatggtgttcctcttggaggtattggt
gctggaagcataggaaggagttttaaaggtgaattccaaagatggcaattatttcctcca
aaatgtgaagatgaaccagttctagcaaatcagttctcagcatttgtttcacgagccaat
ggtaaaaagtactcaagcgtgttgtgtcctaagaacccaaagcttggcaaacaagagtca
gaatctggaattggttcctgggactggaatctgaaaggagacaagtctacatatcatgct
ttatatccgaagtcttggacaatgtatgagggtgaacctgatccagagcttaggattgtt
tgtcgtcaagtttcaccctttatacctcacaactacaaagaaagcagctttcctgtgtct
gtattcactttcacacttcataatcttggaaacactactgcagatgtgacattgctcttc
acatgggcgaattctgttggaggagactcagagttctcaggtggccactacaactccaag
ataatgatgaaagatggagtccaaggtgttcttttacaccataaaacagcaaacgaatta
ccatcactctcatatgcgatttcagctcagtccaccgatggtgttaatgtctcagcctgc
ccatttttcatagtatctggaaaacagaatggaaccacagcaaaagatatgtggcaagtt
attaaggagaatggttcttttgatcactttgaggcttctgaggcatcgatgcagtcagag
cacggatcatcaatcggggcagcagtagcagcctctgcaacagtcccaccaggagagtca
cgcatcgtcacattttctctggcttgggactgccctgaagtgcagtttcctagtggtaaa
atatattctaggcgttacacaaaattttatggaactgatggtgatgctgcagcacaaatt
gcatatgatgctattcttcaacatagtcaatgggagtcctggatagaagcctggcaaaga
ccaatacttgaagacaagaggctgcctgaatggtaccctatcactctcttcaacgagctt
tattaccttaattcaggaggaactctttggacagatggatcatccccagtacatagcttg
gcaggagtcagagaaaagaagttctcacttgataaatcccaactcggtctgaagaatgat
atcgatgtaccgcgtcagaatgatacagctatctctgtacttgaaaagatggcatctaca
ctagagcaacttcatgcatcaacagcatcaaactctgcatttggcacaaaattacttgaa
gaaggagaagagaacattgggcacttcctttacctcgaagggattgaatatcgtatgtgg
aacacctacgatgttcatttctatgcatcttttgcactggtgatgctgtttccaaaactg
gaacttagtatccagagagactttgctgctgcagtgatgctacacgatccaactaaagtt
aaaactcttagcgagggacaatgggttcagaggaaggttcttggtgcagttcctcatgac
ttaggcatcaatgacccttggtttgaagtcaatggatataatcttcacaacacagatcgg
tggaaagatttgaaccccaaattcgtcctccaggtgtaccgagacgtagttgccacaggc
gacaagaagtttgcagtagcggtttggccctcagtgtatgttgcaatggcatatatggct
cagtttgacaaagatggcgatggaatgattgagaacgaagggtttccagaccagacttac
gatacatggtccgcgtctggtgtaagcgcatactgtggtggactttgggtggctgcactg
caagctgcatccgcattggcacacgtagttggtgacaagaactctcaggactatttctgg
tcaaagtttcagaaagcaaaagttgtatatgagaagaagttgtggaatggttcatatttt
aactatgacaccagtggaagtcagtatagctcgtctatccaagctgatcaactagctggt
caatggtacgctagagcatcaggccttttccctattgtagatgaagacaaggcaagaacg
gctttggagaaagtttacaacttcaacgtgatgaagatcaaagatgggaaacgtggagct
gtaaacgggatgcaccccaatgggaaagtcgatacagcgtcgatgcaatcacgagagata
tggtcaggtgttacatatgcactttctgcaacaatgatccaagaaggtctagttgaaatg
gcgtttcagactgcaagtggcgtctatgaagctgcttggtctgaaaccggactcggttac
tcctttcagacgcctgaagcatggaacacgaatgatgagtatagatcactgacttacatg
cgtccccttggaatatgggctatgcaatgggcactaacaaaaaccagtaaagaacagaaa
caaattggtcttgaaccagaacaagaaccagaggcaagctctttaatgaaacatgacatg
ggtttctccagggtttcgaggcttctcaacttacctaacgaagcatcagcgaaaggcaca
ctacagactttgttcgcctatacttgccggagatttatgtcatag

DBGET integrated database retrieval system