KEGG   Capsella rubella: 17878281Help
Entry
17878281          CDS       T02984                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 10 isoform X2
Organism
crb  Capsella rubella
Brite
Enzymes [BR:crb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17878281
Protein kinases [BR:crb01001]
 Serine/threonine kinases: TKL group
  IRAK family
   17878281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung DUF3403 APH Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 17878281
NCBI-ProteinID: XP_006283286
UniProt: R0GHA4
Position
Unknown
AA seq 654 aa AA seqDB search
MSAYACFIFLFVFSSLTSSTVWAQNHTYVGHACRDERTFTRNSTYFTNLKTLWSSLSSRN
ASYTTGFQNATAGQEPDKVTGLFLCRGDLSPEVCRSCVTFSINESLTLCPNQREGVLYYD
ECMLRYSDRNILSTVSLDGVGLGALSTSSNKDVPSNQFQLFNKVLLLTMNQAASYAAVSS
RKFDARKANITASQTVYGLVQCTPDLTTQDCYTCLQKATNQLATNKLGGRSLFPSCSSRF
DISPFYNETAVRPPPPPVSAPPLPRKGGKSKLLVLPIVASTIVVVLLLIACYRFISKKAH
HKAPAFDGDEGATADSLKLDYKTIQAATNGFSESNKIGRGGFGEVYKGTFSNGTVVAVKR
LSKTSGQGEVEFKNEVVVVAKLQHRNLVRLLGFCLEGEERILVYEFVPNKSLDSFLFDPS
KQGELDWTRRYKIIGGIARGILYLHQDSQLTIIHRDLKASNILLDADMNPKIADFGMARI
FGMDHSAENTNRIVGTYGYMAPEYAMQGQYSIKSDVYSFGVSVLEIISGKKNSSFYQTDG
AHDLLSYAWRLWRNGTPLDLVDPVIIHNCQRDELVRCIHIGLLCVQEDPVDRPTLSAIVL
MLTSNTVTLPVPKEPGLFFQSRSKEGLINSEQSFKSRSVPWSVDDSTITDLYPR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttacgcctgtttcatattcctttttgtcttctcatctctcacgagctccact
gtttgggctcaaaatcatacttatgttggccatgcctgtcgggatgagagaactttcact
agaaacagcacttacttcaccaatctcaaaaccctttggtcctctctctcttcccgcaac
gcctcttacaccaccggattccaaaacgcaacggctggacaagaacccgacaaagtcacc
ggacttttcctctgccgtggagacttatcccctgaagtttgccgtagctgcgtcactttt
tccataaacgaatccttaactctgtgtccaaatcagagagaaggcgtgctctattacgat
gagtgtatgctcagatactctgaccggaatattctttccaccgtgtcactagacggtgtt
ggtctcggtgcactgtccactagtagcaacaaggatgttccatctaaccaattccaacta
ttcaacaaggtgttgctactcaccatgaaccaagccgccagctatgccgcggtaagttct
agaaaatttgatgcgagaaaagccaatatcacagcatcccaaactgtgtacggattggtt
cagtgcactcccgatctgacaacacaagactgttacacttgtctgcaaaaagccaccaat
caattagccactaacaaacttggcggaaggagtctttttccgagttgtagttccagattc
gatattagcccattctacaacgaaaccgccgttagacctccaccaccgccagtttcagct
cctccactacctaggaaaggtgggaaatcaaagttactagtcttaccaattgttgcgtct
actatagtggttgttctacttctcatagcttgttatcgttttatttcaaagaaggctcat
cataaggcgcctgcatttgatggagatgaaggagcaaccgcagactcgctgaaacttgac
tacaaaacaattcaagctgcaaccaatggtttttcagagagtaacaagattggtcgaggt
ggatttggcgaggtttacaagggtactttttcaaatgggactgtagttgcggtgaagaga
ctgtcgaaaacatcaggacaaggggaagtagagtttaagaacgaagttgtagtggttgca
aagcttcagcatagaaatctggttaggcttctcgggttttgtttagaaggagaagaaaga
atactagtctacgagtttgtgcccaacaaaagcctcgatagcttcctgttcgatccttca
aagcaaggtgagctggactggactcgacgttacaagattattggaggaattgctagagga
attctatatctccatcaagattcacagctcacaatcatacaccgtgacctcaaagcgagt
aacattctcctagacgcagatatgaatccaaaaatcgctgattttggaatggcaaggata
tttggaatggaccactccgcagagaacacaaacaggatagttggaacctatgggtacatg
gctccagagtatgcgatgcaaggtcagtattcgataaaatcggatgtatatagctttgga
gtgtcagtacttgagataataagtggcaagaagaatagtagcttctaccaaacagatggc
gcacatgacttgctctcatatgcttggaggctttggagaaatgggacaccgttagacctt
gtggatccggttattatacataattgccaaagggatgagttggttagatgtatccatatc
ggtcttttatgtgttcaagaagatcctgtagaccgtccaaccttatcagccatcgttcta
atgctcactagtaacaccgtgactttaccggtgcctaaggaaccagggcttttctttcag
agtagatccaaagaaggcctgattaattcagaacaatcttttaaaagcagatctgttcct
tggtctgttgacgactccacgatcaccgatctatatcctcgttga

DBGET integrated database retrieval system