KEGG   Capsella rubella: 17878619Help
Entry
17878619          CDS       T02984                                 

Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
crb  Capsella rubella
Pathway
crb00600  Sphingolipid metabolism
crb01100  Metabolic pathways
Module
crb_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    17878619
Enzymes [BR:crb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     17878619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 17878619
NCBI-ProteinID: XP_023635461
Position
Unknown
AA seq 480 aa AA seqDB search
MDRQTENDPPAIISDRVLVNGVVTPLALTADGEIRWMESGRRKSTAEKDVLSFVVEGNKV
RVKTLVERGGGICCEGNAGDYTRKDFVFEPLSDESRKLWCDKLHQHLDSLGRPKKLFVFV
NPFGGKKSARKIFVEEVKPLFEDANIQLEIQETKYQLHAKEIVRSMDVSKYDGIVCVSGD
GVLVEVVNGLLERADWRTALKLPIGMVPAGSGNGMIKSLLEPVGLPCSATSAAISIIRGR
TRSLDVATISQGTTKFFSVLMLAWGLVADIDIESEKFRWMGSARFDIYGLQRIICLRQYN
GRILFVPAPGFESYGQPASCSLDKEPSVSDKAIGYQGPDTRLEDLGWREMKGPFVSVWLH
NVPWGAENTLAAPDAKFSDGFLDLIVMKDCPKLALLSLMTKLNDGTHVQSPYVSYLKVKA
FVLEPGARLDEPDKEGIIDSDGEVLARGRRSYKCDQKALMSYSKLQISVDQGLATLYSPE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtcagacggagaatgatcctccggcgataatctccgaccgagttctggtaaat
ggtgttgttacgccgttagctttgactgctgacggagagatacggtggatggaatctgga
cggcggaaatcgacggcggaaaaagatgtactgagtttcgtcgtggaaggtaacaaggtt
agagtaaagacattggtagagagaggaggaggaatttgctgcgaaggaaatgctggagat
tacacgaggaaggatttcgttttcgagcctctctctgatgaatctagaaagctttggtgc
gataagctccatcaacacctcgactctctcggtcggcccaagaaactgtttgtatttgtg
aatccgtttggcgggaagaaatcagcgaggaagatttttgtagaggaagtaaaaccattg
tttgaagatgctaatattcaacttgagattcaagaaaccaagtaccagttgcatgctaag
gaaattgttaggtccatggatgtatcaaaatacgatggtattgtttgtgttagtggtgat
ggtgtccttgttgaggttgtaaatggactgcttgaaagagcagactggagaactgcctta
aaattgccaataggaatggtccctgcaggaagtggtaatggcatgatcaaatcattgttg
gaaccggtagggcttccttgtagtgcaacaagtgccgctatttcaattattcgaggtcgt
acacgttctctagatgttgcaactatctcacaagggactaccaaattcttcagcgtcttg
atgcttgcttggggtttagtggctgatatagacatcgagtcagagaagttcagatggatg
ggtagtgctcgctttgatatctatggtcttcagaggataatatgcttaagacaatacaat
ggacggattctatttgtgccggcacctgggtttgagagctatggccaaccagccagttgc
agtttagataaagagccatctgttagtgataaggcaattggataccaaggtcctgatact
agacttgaagatctgggctggagagaaatgaaaggcccatttgtttcagtatggcttcat
aatgttccctggggtgctgagaacactttggctgctcctgacgcaaagttttctgatggg
ttcctggatttgattgtcatgaaagactgtcctaagcttgccttgctatcacttatgaca
aaattgaatgatggaacacatgttcagtcaccatatgtatcatatctgaaggtgaaggca
tttgtgctggagccaggtgcacgcctagacgaaccagacaaggaaggaatcatagattca
gatggagaggtattggcaagaggaagaagatcatacaaatgtgatcaaaaggctttgatg
tcttacagcaagcttcaaataagtgttgatcaaggtttagcaactctctactctcctgaa
taa

DBGET integrated database retrieval system