KEGG   Capsella rubella: 17879511Help
Entry
17879511          CDS       T02984                                 

Definition
(RefSeq) xylogalacturonan beta-1,3-xylosyltransferase
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
crb  Capsella rubella
Brite
KEGG Orthology (KO) [BR:crb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:crb01003]
    17879511
Enzymes [BR:crb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     17879511
Glycosyltransferases [BR:crb01003]
 Polysaccharide
  Structural polysaccharide
   17879511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Orbi_VP4 Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 17879511
NCBI-ProteinID: XP_006283529
UniProt: R0F3Y4
Position
Unknown
AA seq 518 aa AA seqDB search
MAAPRSRRCSLSLLTFISISLILIISVSLFVFTTKPTNKPLIDYRNQFSIVSVSFPLSLS
PLGHNTSLAAPVSSPSSNPTNTSTLASSSPLVLPLLKESNTTTNTTLSSGYDDQQQNQNK
SPSPTSKRVVIKKRSGLDKIESELAKARAAIKKAASTQNYVSSLYKNPAAFHQSHTEMMN
RFKVWTYTEGEVPLFHDGPVNDIYGIEGQFMDEMCVDGPKTRSPFRANRPEDAHVFFVPF
SVAKVIHYVYKPIRSVDGFSRDRLHRLIEDYVDVVATKYPYWNRSLGGDHFMVSCHDWAP
DVIDGNPKLFEKFIRGLCNANTSEGFRPNVDVSIPEIYLPKGKLGPSLLGISPRIRSILA
FFAGRSHGDIRKILFKHWKERDNEVQVYDRLPPGKDYTRLMGMSKFCLCPSGWEVASPRE
VEAIYAGCVPVIISDNYSLPFSDVLNWDSFSIQIPVSRITEIKTILQSVSLVRYLKMYKR
VLEVKQHFVLNRPAKPYDVMHMMLHSIWLRRLNLRIGT
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggctgctccaagatcaagaagatgctctctttctttgttaacctttatctcaatatct
cttattcttataatttcagtttcactatttgtcttcacaacaaagccaactaataagcct
ttgattgattacagaaaccaattctctattgtctctgtctctttccctctttctctttct
cctcttggacacaacactagtcttgctgctcctgtctcttctccttcaagcaacccaaca
aacacaagtactcttgcttcttcttctccactagtactacctcttcttaaagagagcaat
acaacaacaaacactactctttcttctggttatgatgatcaacaacaaaaccaaaataag
tctccaagtcctacaagtaaaagagttgttatcaagaagagaagtgggttggataaaata
gaatcagaattagcaaaagcaagagcagcaattaagaaggcagcttcaacacaaaactat
gttagctccctctacaaaaacccagccgcctttcatcagagtcacacggaaatgatgaat
aggtttaaggtgtggacatacacggaaggagaggtcccattgttccatgatggccctgtg
aatgacatttacggcatagaaggacaattcatggacgaaatgtgcgtggacggccctaag
actagaagcccttttcgggccaatcgtcccgaggatgctcatgttttcttcgtgccattt
agcgttgccaaggtcatacactacgtttacaagcccatccgctctgtcgacgggttttcg
cgggatcgtcttcaccgtcttatagaggattatgttgatgtagttgctactaagtatccc
tattggaacagaagccttggaggcgaccatttcatggtatcatgccatgactgggcacca
gatgtgattgatgggaatccaaagttgtttgaaaaattcataagaggactttgcaatgct
aacacctcggaaggattccggcctaatgtggatgtatccattcccgagatctaccttcct
aaaggtaaattaggtccatctttactcggaatatcaccgagaattcgatctatactcgca
ttttttgctggaagaagtcacggtgatatccgaaaaatcttatttaaacattggaaagag
agggacaatgaagtccaagtctatgaccgtcttcccccgggaaaggactatacaagacta
atgggaatgagcaagttttgtctatgtccgagtggttgggaagtcgctagcccgagagag
gttgaggctatatacgctggttgtgtaccggtgatcatatcggataattattcattacca
ttcagtgatgtgcttaattgggattcattctctatacaaatccctgtgtccaggataaca
gagatcaaaaccattctgcaaagtgtctctcttgtaagatacttgaagatgtataagaga
gtgttagaagtgaagcagcattttgtgttgaatcgtccagctaaaccctacgatgtgatg
catatgatgcttcactctatctggttaaggcgacttaatcttaggattggtacatag

DBGET integrated database retrieval system