KEGG   Capsella rubella: 17879532Help
Entry
17879532          CDS       T02984                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
crb  Capsella rubella
Pathway
crb00450  Selenocompound metabolism
crb00970  Aminoacyl-tRNA biosynthesis
crb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    17879532
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    17879532
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:crb01007]
    17879532
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:crb03016]
    17879532
Enzymes [BR:crb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     17879532
Amino acid related enzymes [BR:crb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   17879532
Transfer RNA biogenesis [BR:crb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    17879532
 Prokaryotic type
   Other AARSs
    17879532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g Anticodon_1
Motif
Other DBs
NCBI-GeneID: 17879532
NCBI-ProteinID: XP_006285215
UniProt: R0H3L0
Position
Unknown
AA seq 700 aa AA seqDB search
MEDDANSIPKLPIPGKRNILITSALPDVYNVPQLGNITGCVLRADVYARYCRLRGYNALY
ICGTDEYGTSTVFSEENCTAKEICDKYHAVHKDVYDWFDITFDKFGRTSTPEHTQVCQAV
YSKLWELSEETTKQLSCYYCKQFFSADFLDPYGGCNHDPVRRDQCKTFRKLLNPPDLKYL
CCKLCHIPLQIANTDQLNFELQLERYIDETSAAGAWGQNAIQSTKAWLEKGIGKIVITRD
LKWGVPLPSEKYEDKVFYVWHNAPIGYVSITSCYTSEWEKWWKNPENVELYQFMGKDTVP
HHTVMFPSMQLGTGENWTLVKTISVTEYLNYKGGKLSKNKGAGVFGNAVKDTSIPVEVWR
YYLLTDMPEVSDASFVSKDLQAKLNNKSLSNLGNFVKRVLSFIAKPESAGYGSVVPDAPG
AESHLPTVSLGRKVGKLVEEYVEAMEKVKLKQGLKTAMSISVEGNRYLQEFQLRKLDRTD
KPYCAIVIRTAAGLIHLLAQLLEPFMPSFSREVFKQMNLPPHFSLSDERGEVLQASRPWK
ILPPSHMIGTPQLLFKELKGEEMQQYVEKCLADRCASDAAASRRRARRHAARIRRYAEEP
ANLITRLRLRSREASSSKSDRATLEAGWDKGMHETCTNSSHDGALADLVDQLRRERLESR
AARSSETKGGAIQMLTCAEAQANWVQKRLGSREASGLGAD
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgacgccaatagcatcccgaagttgccgatccctggcaaaagaaatatacta
atcacaagcgctctgcctgacgtctacaacgtccctcagctcggaaatatcactggctgt
gttctgagagctgatgtatatgctagatactgtcgtctccgtggctacaatgctctatat
atctgtgggactgatgaatatgggacttcaactgttttcagcgaggagaattgcaccgcc
aaggaaatctgtgacaagtaccatgccgttcataaagatgtttatgactggtttgatata
acttttgacaagtttgggcgaacttcaacgccagaacatacccaagtgtgccaagcagtt
tatagtaagttgtgggaactttcagaagaaaccacaaagcagctttcctgctattattgc
aagcagttcttctcagctgactttcttgatccatacggaggatgtaatcatgatcctgtt
cgtcgagatcagtgcaaaacatttagaaagcttctgaaccctcctgatctcaaatatctc
tgttgcaagctctgtcatataccacttcaaattgccaacacagaccaactgaattttgag
cttcagttggaaaggtatattgatgagacatctgctgctggagcgtggggtcaaaatgct
attcaatctacaaaggcgtggcttgaaaaagggattggaaagatagtcattacaagggat
ctaaagtggggagttcctctcccatctgagaaatatgaggataaagtcttctacgtttgg
cataatgctcctattggttacgtgtcaataacttcatgctacacatctgaatgggagaag
tggtggaagaatcctgagaacgtcgagctttatcagtttatgggtaaagacactgtgcca
catcacactgtgatgtttccctctatgcagcttggaactggggaaaattggacactggtg
aagacaatcagtgtgactgaatatttaaattacaaaggcggaaagttatccaagaataaa
ggcgctggagttttcgggaatgctgtaaaagatacaagtatccctgtcgaagtatggagg
tactacttactgaccgacatgcctgaggtgtctgacgcatcatttgtgtcgaaggatttg
caagcaaaactgaataacaagtcactgagcaaccttggcaactttgttaaacgagttctg
agttttatagcaaagcccgaatctgcagggtatgggtctgtcgttcctgacgctcctggt
gctgaatctcatcttccaacggtgtcactagggagaaaggttggaaaattggtggaggag
tatgttgaagccatggaaaaggttaagctcaagcaggggctgaaaactgctatgagtatt
tcggttgaagggaacagatacttgcaggaatttcaactacggaaacttgaccgtacagat
aaaccttattgtgcgattgttataagaaccgcggctggtttaatacaccttcttgcacaa
ttgttagaacctttcatgccatccttttctcgcgaggtatttaaacagatgaacttgcct
ccacatttttccctctctgacgaaagaggagaggtgttacaagcaagtagaccttggaag
attctacctccgagccacatgataggcacacctcaactattgttcaaggaattgaaaggt
gaagagatgcaacagtatgtagaaaagtgtctggctgatagatgtgctagtgatgcagct
gcgagtcgtaggcgtgctaggagacatgcagctcgcattcgtagatacgccgaagaacca
gcaaatctgatcacgcgactacggttgagatcgagggaggcaagcagcagcaaatctgac
agagcaacattagaggctggttgggataaagggatgcatgaaacttgtactaatagcagt
catgatggagctctagcagatctggtggatcaacttaggagggaacgattggaatcaagg
gcggcacgcagctctgaaacgaaaggcggagcaattcagatgcttacatgtgctgaagca
caagcaaattgggtgcagaaacggttgggatcgagggaggcttcaggtctaggggccgat
tga

DBGET integrated database retrieval system