KEGG   Capsella rubella: 17879602Help
Entry
17879602          CDS       T02984                                 

Definition
(RefSeq) heat shock 70 kDa protein 6, chloroplastic
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
crb  Capsella rubella
Pathway
crb03040  Spliceosome
crb04141  Protein processing in endoplasmic reticulum
crb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:crb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    17879602
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    17879602
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    17879602
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:crb01009]
    17879602
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:crb03041]
    17879602
   03009 Ribosome biogenesis [BR:crb03009]
    17879602
   03110 Chaperones and folding catalysts [BR:crb03110]
    17879602
   04131 Membrane trafficking [BR:crb04131]
    17879602
   03051 Proteasome [BR:crb03051]
    17879602
   03029 Mitochondrial biogenesis [BR:crb03029]
    17879602
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:crb04147]
    17879602
Protein phosphatases and associated proteins [BR:crb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     17879602
Spliceosome [BR:crb03041]
 Complex B
  Other components
   Prp19 complex
    17879602
 Complex C
   Prp19-CDC5 complex
    17879602
Ribosome biogenesis [BR:crb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    17879602
Chaperones and folding catalysts [BR:crb03110]
 Heat shock proteins
  HSP70 / DNAK
   17879602
Membrane trafficking [BR:crb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    17879602
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    17879602
Proteasome [BR:crb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    17879602
Mitochondrial biogenesis [BR:crb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    17879602
Exosome [BR:crb04147]
 Exosomal proteins
  Proteins found in most exosomes
   17879602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA FGGY_C StbA DUF5398 PilM_2 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 17879602
NCBI-ProteinID: XP_006283214
UniProt: R0F380
Position
Unknown
AA seq 717 aa AA seqDB search
MASSAAQIHVLGGVGFANSSSKRNLNGKGGTFMPRSAFFGTRTGPFSTPTSAFLRMGTRN
GGGTSRYAVGPVRVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKS
GDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMNEVDEESKQVSYRVVRDENGNVKLECPA
INKQFAAEEISAQVLRKLVDDASRFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLEV
LRIINEPTAASLAYGFDRKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGD
DFDKRVVDWLAAEFKKDEGIDLLKDKQALQRLTEAAEKAKIELSSLTQTNMSLPFITATA
DGPKHIETTLTRAKFEELCSDLLDRVRTPVENSLRDAKLSFKDIDEVILVGGSTRIPAVQ
ELVRKVTGKEPNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVTPLSIGLETLGGVMTK
IIPRNTTLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVP
QIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDKEKR
DAIDTKNQADSVVYQTEKQLKELGEKIPGDVKEKVEAKLQELKDKIGSGSTQEIKDTMAA
LNQEVMQIGQSLYNQPGAGAPGAGAPPGGEGASSGDSSSSKGGDGEDVIDADFTDSK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttccgccgcccaaattcacgttctcggcggagttggattcgctaattcttct
tccaagagaaatctcaatggtaaaggtggtacctttatgccgagaagtgccttcttcggt
acaagaactggtcctttctccacacccacttctgctttcctcagaatgggcactagaaat
ggcggcggaacttctaggtacgcggtaggtccggtgcgtgtggttaacgagaaggttgtt
ggtatcgatttgggtacgactaactccgccgttgctgctatggaaggaggtaagcctacg
attgtgactaacgctgaaggtcagaggactacgccgtctgtggtggcttacacgaagagc
ggtgacaggcttgttgggcagattgcgaagaggcaagctgttgttaatccggagaatact
ttcttctctgtgaagaggtttattggtaggaagatgaatgaggtcgatgaggagtctaag
caggtttcttacagagttgtcagggatgagaacgggaatgttaagctcgagtgtcctgct
attaacaaacaatttgctgcagaggagatttcagctcaggttttgaggaaacttgtggat
gatgcctcaagattcttgaacgacaaagtaaccaaggctgtcatcactgtgcctgcttac
ttcaacgactcacagaggacagcaacaaaagatgctggtcgaattgctggtttggaagtt
cttcgtattatcaacgagcccacagctgcttcattggcttatgggtttgacagaaaaagc
aatgaaacaatcctagtctttgatcttggtggtggtacctttgatgtttcagtacttgag
gttggtgatggtgtgtttgaagtgctttccacttctggcgacacacatttgggtggtgat
gactttgacaagagagttgttgattggcttgctgcagaattcaagaaagatgaagggata
gatcttctgaaagacaagcaagctcttcagaggttaacagaggcagcagaaaaagctaaa
atcgagctttcctcgctgactcagacaaatatgagcttgccatttatcacggccacagct
gatggacccaaacacatagaaactactctcacacgtgccaagtttgaagaattatgttca
gatttgctggacagggtcaggactcccgtcgagaattccctaagggatgcaaagctaagc
ttcaaagatattgatgaagttatccttgtcggtggatccacacgtattcctgctgttcag
gagcttgtaaggaaggtgactgggaaagaacctaatgttacagtaaatcctgatgaggtt
gtagccttaggtgctgcagtccaggctggtgttctcgctggagatgtgagtgacattgtg
cttcttgatgtgacaccactttctattggtttggagaccctgggaggtgttatgaccaag
atcattccgaggaacactacactacctacttcaaaatcagaagtcttttcgactgctgct
gatgggcagacaagtgttgagattaatgtgctgcagggtgagagggagtttgttagggat
aacaagtctcttggcagcttccgtctagatggtattccacctgcaccacgtggagttcca
caaattgaagtcaaatttgacattgatgccaatggaattctatccgtcagtgctgttgac
aaaggtaccggcaagaaacaagacatcaccattactggtgccagtacattgcccaaggat
gaggtagaccaaatggtccaggaagcagaaagatttgcaaaggatgacaaggagaagaga
gatgcaatcgacacgaagaaccaagcagattcagtggtgtaccagacggagaagcaacta
aaagaacttggtgagaaaattccaggtgacgtgaaagagaaggtggaggctaagctacaa
gagctgaaagacaagataggaagcggatcaacgcaagaaataaaagacaccatggcagct
cttaaccaagaagtgatgcagattggtcagtctctatacaaccagcctggagctggagcc
ccaggtgctggtgctcccccaggtggtgaaggtgcttcatcaggagattcatcttcaagt
aaaggtggagatggtgaagatgtgatcgatgctgacttcacagacagcaaatga

DBGET integrated database retrieval system