KEGG   Capsella rubella: 17881435Help
Entry
17881435          CDS       T02984                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
crb  Capsella rubella
Pathway
crb03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:crb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    17881435
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:crb03041]
    17881435
Enzymes [BR:crb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     17881435
Spliceosome [BR:crb03041]
 Complex C
  Other components
   Step II factors
    17881435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD zf-RING_UBOX zf-C3HC4_2 zf-C3HC4 AAA_22 zf-RING_5 zf-RING_2 AAA_19 Helicase_RecD zf-C3HC4_3 AAA_30 ResIII AAA_29 KH_1 ABC_tran Secretin_N RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 17881435
NCBI-ProteinID: XP_006286881
UniProt: R0GSC1
Position
Unknown
AA seq 1803 aa AA seqDB search
MRSSFPPSDGGRSATDRRLPSFPSSSTNRCNSHSPQFSPPLSHRHTRNQHHSQYPKPNFP
PNYSRDRALSPGFSSSETRIRPNFIVQLLHPRINAAANSDPKLYFSAKRQEIKSLALLFE
IPEESVHLPQFGCVAGSFSFRQWVDARSAVVALWEYRLQGKHDFVPELVPNVVVPSDMGE
LEDRLRDLFSAHVLSLIESGEGVRKVKIEIDEKTRQVESFSSKRGLLKFEVFEKKKAAEA
ERDLVVKRLQEFMNAMKSIVRFLKGKDVYESDGEEEDVAVFSLEGAYDWRRIHNLIRREC
RRLDDGLPIYAYRRNILKRIHGEQITVLIGETGSGKSTQLVQFLADSGVAASESIVCTQP
RKIAAMTLADRVREESSGCYEENYVRCTPTFSSTEQISSKVVFMTDNCLLQHYIKDRSLS
GISCVIIDEAHERSLNTDLLLALLKELLCTRVDLRLVIMSATADASQLSDYFFGCGKFLV
NGRNYPVDIVYSPCDTEETSVVGGIAPYVADVVKMAVEIHKTEKEGTILAFLTSQAEVEW
ACERFIAPSAVALPLHGKLSFEEQYRVFQNHPGRRKVIFATNIAETSLTIPGVKYVIDSG
MVKESKYEPRTGMSILKVCWVSQSSARQRAGRAGRTEPGRCYRLYSQNDFDSMNFNQEPE
IRRVHLGVAILRILALGIDNIADFDFVDAPVPEAIAMAVQNLVQLGAVVQKNSVLELTQE
GHCLVKLGLEPKLGKLILSCFRYRMGKEGIVLAAVMANASSIFCRVGNLDDKMKADRLKV
QFCNHNGDLFTLLSVYKEWASLPRERRNKWCWENSLNAKSMRRCEDTVKELEICIERELT
LVSPSYWVWNPSEGTKHDKHLKMAILASLAENVAMYTGYDQLGYEVALTGQQVQLHPACS
LLAFGQKPSWVVFGELLSIVDQYLVCVTAIDFEALYTLDPPPPFDASQMDERRLRVKKVV
GCSSTVLKRFCGKSNRSLLSIVSRARSLCRDERICIQVDVDQNAILLYASPLDMEKVSAL
VNDALECEKKWMRNECLEKYLFHGRGQVPIALFGSGAQVKHLEVDQRFLTVDVLCYGDNV
VDDRELLTFLEKSIDGCICSIHKFAANKQDCDEQEKWGRLTFLTPESAMKATEIQKFDFN
GSVLKLFPSLSTSGGNFKMPSFPSVTAKIIWPRRESTGRGCLKCPSGDIHSILGGISGLV
IGTCYAHIQRDHKSNDSILISGLDSDLSEAEVLDVLEFTTGIKDLKFFIFRKNCVQCPSP
TTCEEELYKRIFAHMSARNPEPNCVKVQVFEPREKDYFMRALITFDGRFHLEAAKALQEL
NGEVLTGCLPWQKIKCEQLFQSSIICSSSIYNTVKRQLNVLLASFERQRGGDWHLEETHN
GAYRVKICAYATRPIAEMRKELEELVRGRPINHPGLTPRVLQHLMSRDGITLMRKIQQET
ETYIVLDRHNLTIRICGSSEKIAEAERELVQSLMAYHESKQLEIHLRGPDIRPDLMKEVV
KRFGPELQGIKEMVHGVDLKLNTRYHVIQVHGSKEMRQEVQKMVNELARDESALGEKPDD
IEVECPICLSEVDDGYSLEGCSHLFCKACLLEQFEASMRNFDAFPILCSHIDCEAPIVLA
DMRALLSQQKLDELFRASLSFFVTSSDGKFRFCSTPDCPSIYRVAGSQESGEPFICGACN
AETCTRCHLEYHPLITCERYKQFKENPDLSLKDWAKGKDVKECPICKSTIEKSFGCNHLQ
CRCGKHICWTCLDVFTHSEPCYAHLRAVHGGIGLGDGLGEAGEDVGLGIPFFEFGIPIGI
PRP
NT seq 5412 nt NT seq  +upstreamnt  +downstreamnt
atgaggagctcttttcctccttccgacggtggaagatcggcgactgatcgtcgtcttccg
tcgtttccctcatcctccacgaaccgttgtaactctcactctccacagttttctccgccg
ctcagccaccgtcatactcggaaccagcatcactctcagtaccctaagcccaatttcccg
ccaaattacagtcgcgatcgggctctgtcgccggggttctcgtcttcagagactcgtatt
aggccgaattttatcgttcagctgcttcacccgaggattaacgccgccgctaacagtgac
ccgaagctttacttttcggctaagagacaagagatcaagagtctcgctttgctttttgaa
atcccggaggaatctgttcatctgcctcagttcggttgtgtcgccggaagtttcagtttt
cgtcagtgggtcgatgcgcgctctgcagtcgtggctctttgggaatatcgtcttcaaggg
aaacatgattttgttcctgagctggttcccaatgttgttgttccttcagatatgggcgag
cttgaagacaggcttcgtgatcttttctcggctcatgttctttcgcttattgagagtgga
gaaggcgtcaggaaggtgaaaattgagatagatgagaaaactcgtcaagttgagtccttt
tcgtctaaaaggggtcttcttaaatttgaggtttttgagaaaaagaaggctgcagaggcg
gagagagatttggttgtgaagcggcttcaagaattcatgaatgccatgaagagcattgtg
cgattcctcaaaggaaaagacgtgtacgagtctgatggagaagaagaagatgtagccgtc
tttagtttggaaggggcctatgattggagacgtatccataatttgattcgtagggagtgt
agaaggctggatgatggactgcctatctatgcctaccggcggaatattctgaagcgaata
catggtgaacagattacggtattaattggagaaactggttcagggaagagcactcagttg
gttcagttccttgctgattctggagttgctgctagtgagtcgattgtttgtacacaacca
cggaaaattgctgccatgacattggctgatcgggtcagagaggaaagcagtggttgttat
gaggaaaattatgtccgttgtactccaactttttcttctaccgagcagattagttccaaa
gttgtattcatgacagataattgtctgcttcaacactacataaaagataggagtttatct
ggcatttcatgcgttattattgatgaagcccatgaaagaagcttaaatacagaccttctt
ctggcattgctcaaggagttgctatgcacaagggttgacctaaggcttgtcatcatgtct
gccacggccgatgcctcccaactttcagactatttcttcggttgtggaaaatttctggtc
aatgggaggaactatccagtggatattgtatattccccttgtgacaccgaggagacttct
gttgttggcggcattgctccatatgttgctgatgttgttaagatggctgtggaaatacat
aaaacagagaaagagggaaccatccttgcgttcttgacttcccaagcagaggtagaatgg
gcatgtgaaaggtttatagctccatctgcagttgctttgcctttacatggaaagctttcc
ttcgaagaacaatatcgagttttccagaaccatcctgggagacgaaaagtgatttttgcc
acaaatattgcagagacatcgctgactattcctggcgtcaagtatgttattgattccggg
atggtaaaagagagtaaatatgaacctagaacaggtatgagcatcctcaaggtgtgctgg
gtcagtcagagttctgctcgacaacgtgctggtcgtgctggaaggacagaacctggaaga
tgttacagactgtactcacaaaatgattttgattcaatgaattttaatcaggaacctgaa
attcggagggttcatcttggtgtagcaattttgaggattcttgctctgggtatagacaac
atagcagattttgactttgttgacgcgcctgtcccggaagccattgcaatggctgtccaa
aaccttgttcagcttggcgcagtagtacagaaaaatagtgttcttgaattaacacaggaa
gggcattgtttagtcaagctgggtctggagccaaagcttgggaagttaattttaagctgc
tttagatacagaatgggcaaagagggaattgttcttgctgctgtcatggctaatgctagt
agcatattttgcagagttggtaacctcgatgataagatgaaagctgatcgcctaaaggtg
caattctgcaatcataatggagacctgttcactcttctttcggtgtacaaagaatgggca
tctctgccacgagagagaagaaataaatggtgctgggaaaatagcctgaatgccaaatca
atgaggagatgtgaagacacagtcaaggaattggagatatgcattgagagagaacttact
cttgtcagtcctagttactgggtttggaatccaagtgagggtactaaacacgacaagcat
ttgaaaatggctatacttgcatctcttgcagaaaatgtggcgatgtatactggctatgat
cagcttggatacgaggtggcgttgactggtcaacaagttcagttacatccagcgtgttca
ttgctagcattcggccagaagccaagctgggttgtttttggtgaacttctatcgattgtg
gaccagtacttggtatgtgtaactgctattgattttgaggctttgtatacgcttgatcca
ccaccaccttttgatgcatctcagatggatgagcggaggctccgagtgaaaaaagtggtt
ggttgtagcagcactgtgctaaaacgattttgtgggaaatctaatcgtagtctgctttca
attgtttctcgtgctaggtctctttgtagggatgaaaggatttgtattcaagtggatgtt
gatcagaatgcaattctactgtatgcgtctccactcgacatggaaaaagtgtcagccctt
gtgaacgatgcattggaatgtgaaaagaaatggatgcgtaatgaatgtttggagaagtat
ctatttcatggtcggggacaagtacctattgcattgtttggatctggtgctcaggtaaag
catcttgaagttgatcagagatttttgacagtcgatgtactttgttatggcgacaatgtt
gttgatgatagagagcttctgacttttttggagaagagcattgatgggtgtatttgctct
attcataagtttgctgcgaacaaacaagactgtgatgagcaggagaagtggggtagacta
acctttctaactcctgaatctgctatgaaggcaacagaaattcagaaatttgatttcaat
ggatcagttcttaaattatttccctcgctgtcaaccagtggaggaaattttaagatgcct
tctttcccgtccgtgacagctaagattatctggccgcgaagggaaagcactggtagagga
tgtcttaagtgtccttccggagatattcacagtatacttggtgggatctccggccttgtg
ataggtacatgttatgcccatattcaaagagatcacaagtccaatgattctatcttgata
agtgggcttgacagtgatctttcggaagcagaagttttagatgttttggagttcacaact
gggattaaagatcttaaatttttcatattcagaaaaaattgtgtgcagtgtccatctcct
actacttgcgaggaagagctgtataagagaatatttgcgcatatgtcagcaaggaatcca
gagccaaactgtgtcaaagttcaagtttttgaaccaagagaaaaagattatttcatgcga
gcattaattacttttgacgggagatttcatttggaagctgcaaaagctttgcaggagtta
aatggagaggtactaactggatgtcttccatggcagaagataaagtgcgaacaattgttt
cagagctccataatctgctcttcttctatctacaacactgtcaaaagacaattgaatgtt
ttattagcaagctttgagagacaacgagggggtgattggcatctggaagaaactcataac
ggtgcttatcgtgttaaaatttgtgcttatgcaacaagacccattgcagagatgcggaaa
gaacttgaagaactcgtaagaggaagacccataaaccatccaggcttaacccctagagtc
ctgcagcatcttatgtccagagatggtattactctgatgcggaagatccaacaggagact
gaaacttacattgtattagacaggcataatctcacaatacgcatttgtggatcaagtgag
aaaattgccgaggctgaacgagaactggttcagtcacttatggcttatcacgagagcaag
caacttgaaatccatctccgaggtcctgatatccgtcctgacctaatgaaggaagttgtg
aagcggtttggtcccgagctccaaggtatcaaagaaatggtgcatggtgtggatctgaag
ctcaatacccggtaccatgttattcaggttcatgggagcaaagaaatgaggcaagaagta
caaaagatggtcaacgaacttgcacgagatgagagtgcactgggtgaaaaaccagatgac
attgaagttgaatgcccgatttgcttgtctgaagtcgatgatggctattctcttgaagga
tgttcacacctcttctgcaaagcttgtttgttggagcaatttgaggcatcgatgagaaac
tttgacgcattcccaatactttgttctcacattgactgtgaagctccaatagtactcgct
gatatgagagctctcttatcacaacagaagctcgatgaactcttccgagcatccttgtcc
ttctttgtaacatctagtgatggaaagttccggttttgctccacacctgattgcccttcc
atctaccgtgtagctggatctcaagaatccggcgaaccattcatctgtggagcatgtaac
gcagaaacatgcacaaggtgtcacctcgagtatcaccctttaatcacttgtgaaaggtac
aaacagttcaaggaaaatccggatttgtcgctaaaggactgggcaaaagggaaggatgta
aaggagtgtccgatttgcaagtccacgatagagaaatcttttgggtgtaaccatctgcag
tgccgttgtggaaagcacatttgctggacctgcttagacgtctttactcactcagaacct
tgttatgcccatttgagggcagttcatggcggaattggcttgggcgacggcttgggcgag
gctggtgaagacgtgggtctcggcatcccgttttttgagttcggtattccaattggtatc
cccaggccttga

DBGET integrated database retrieval system