KEGG   Capsella rubella: 17882339Help
Entry
17882339          CDS       T02984                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37e
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
crb  Capsella rubella
Pathway
crb03040  Spliceosome
crb04141  Protein processing in endoplasmic reticulum
crb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:crb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    17882339
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    17882339
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    17882339
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:crb01009]
    17882339
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:crb03041]
    17882339
   03009 Ribosome biogenesis [BR:crb03009]
    17882339
   03110 Chaperones and folding catalysts [BR:crb03110]
    17882339
   04131 Membrane trafficking [BR:crb04131]
    17882339
   03051 Proteasome [BR:crb03051]
    17882339
   03029 Mitochondrial biogenesis [BR:crb03029]
    17882339
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:crb04147]
    17882339
Protein phosphatases and associated proteins [BR:crb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     17882339
Spliceosome [BR:crb03041]
 Complex B
  Other components
   Prp19 complex
    17882339
 Complex C
   Prp19-CDC5 complex
    17882339
Ribosome biogenesis [BR:crb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    17882339
Chaperones and folding catalysts [BR:crb03110]
 Heat shock proteins
  HSP70 / DNAK
   17882339
Membrane trafficking [BR:crb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    17882339
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    17882339
Proteasome [BR:crb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    17882339
Mitochondrial biogenesis [BR:crb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    17882339
Exosome [BR:crb04147]
 Exosomal proteins
  Proteins found in most exosomes
   17882339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A FGGY_C
Motif
Other DBs
NCBI-GeneID: 17882339
NCBI-ProteinID: XP_006287234
UniProt: R0FDB4
Position
Unknown
AA seq 651 aa AA seqDB search
MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKILPGPADKPMIYVNYKGEEKQFAA
EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKSKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFED
KMKELESICNPIIAKMYQGAGGEAGGPGAGGMDDDAPPASGGAGPKIEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaaaggtgaaggtcccgcgatcggtatcgatctaggtactacttactcttgc
gttggagtatggcaacacgaccgtgttgagatcattgccaatgatcaaggaaacagaacc
accccatcttacgtagctttcaccgactccgagaggttgatcggtgatgccgctaagaat
caggtcgccatgaaccctgttaacacagttttcgacgctaagaggttgatcggtcgccgt
ttcagcgacagctctgtccagagtgacatgaaattgtggccattcaagattcttccagga
cctgccgacaagccaatgatctacgtcaactacaagggtgaagagaaacagttcgctgct
gaggagatctcttccatggttcttattaagatgcgtgagatcgctgaggcctaccttggt
gtctctatcaagaacgccgttgtcactgttcctgcctacttcaacgactctcagcgtcaa
gccacaaaggatgctggagttattgctggtttgaacgttatgagaatcatcaatgagccc
acagccgcagctattgcctacggtcttgacaaaaaggcaacaagcgttggagagaagaac
gttcttatcttcgatcttggtggtggtacttttgatgtctctcttcttaccattgaagag
ggtatctttgaggtcaaggcaacagctggtgacacccatcttggtggggaagatttcgac
aacagaatggtcaaccacttcgtccaagagttcaagaggaagagcaagaaggacatcact
ggtaacccaagagctcttaggaggttgagaactgcctgtgagagagcaaagaggactctt
tcctccactgctcagaccaccatcgagattgactctctatacgagggtattgacttctac
tccaccatcacccgtgctagatttgaggagcttaacatggatctctttaggaagtgtatg
gagccagttgagaagtgtctccgtgatgctaagatggacaagagcactgttcacgatgtc
gtccttgttggtggttccacccgtatccctaaggttcagcaattgcttcaggacttcttc
aacggcaaagagctttgcaagtctataaaccccgatgaggctgttgcatatggtgctgcc
gtccagggagctattctcagtggtgaaggaaacgagaaggttcaagatcttctgttgctc
gatgtcactcctctctcccttggtttggaaactgccggtggtgtcatgaccactttgatc
ccaagaaacacaacaatcccaaccaagaaggagcaggtcttctctacctactcagacaac
cagcctggtgtgttgatccaggtgtacgaaggagaaagagccagaaccaaggacaacaac
cttctcggtaaatttgagctctccggaatcccaccggctccacgtggtgtgcctcagatc
acagtgtgctttgacattgacgccaatggtatcctcaacgtttctgctgaggacaagacc
accggacagaagaacaagattaccatcaccaatgacaagggtcgtctctccaaggatgag
attgagaagatggttcaagaggcagagaagtacaagtctgaggatgaggagcacaagaag
aaggttgaagccaagaacgctcttgagaactacgcttacaacatgaggaacaccatccag
gacgagaagattggtgagaagcttcccgcagcagacaagaagaagatcgaggactctatt
gagcaggcgattcagtggctcgagggtaaccagttggccgaggcagatgagtttgaagac
aagatgaaggagttggagagcatctgcaacccaatcatcgccaagatgtaccaaggagct
ggtggtgaggccggtggaccaggtgctggtggaatggacgatgatgctcctcctgcttca
ggcggtgctggacctaagatcgaggaggtcgactaa

DBGET integrated database retrieval system