KEGG   Capsella rubella: 17882585Help
Entry
17882585          CDS       T02984                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
crb  Capsella rubella
Pathway
crb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:crb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    17882585
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:crb03032]
    17882585
   03036 Chromosome and associated proteins [BR:crb03036]
    17882585
   03400 DNA repair and recombination proteins [BR:crb03400]
    17882585
Enzymes [BR:crb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     17882585
DNA replication proteins [BR:crb03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     17882585
Chromosome and associated proteins [BR:crb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    17882585
DNA repair and recombination proteins [BR:crb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     17882585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR SAP HARE-HTH HeH
Motif
Other DBs
NCBI-GeneID: 17882585
NCBI-ProteinID: XP_006286374
UniProt: R0FB52
Position
Unknown
AA seq 635 aa AA seqDB search
MASKLKVDELRSKLAERGLSTTGVKAILVERLEEAIAEDTKKEESKNKGKRNRDSSDDTD
ESNKLIAIGEFRGMIVKELREEAIKRGLDTTGTKKQLLERLCNDVNNDSKAPIKSGTEEA
EDDKNGFDEENKEEKIVTATKKGAAVLDQWIPDQIKSQYHVLQRGDDVYDAILNQTNVRD
NNNKFFALQVLESDTKKTYMAYTRWGRVGVKGQSKLDGPFDSCDRAIEIFTNKFCDKTKN
YWSDRKEFISHPKSYTWLEMDYGKENDSSVNDIPNSSSEVKPENSKLDSRVAKFISLICN
VSMMAQHMMEIGYNANKLPLGKISKSTISKGYEVLKRISEVIERFDRQRLEELSGEFYTV
IPHDFGFKKMSQFVIDTPQKLKQKIEMVEALGEIELATKLLSVDPGLKDDPLYYHYQQLN
CGLTPVGADSEEFSMVASYMENTHAKTHSGYTVEIAQLFRASRGVEAERFQQFSNSKNRM
LLWHGSRLTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYANHGANDGV
LLLCEVALGDMNELLYSDYNADNLPPGKLSTKGVGKTAPNPSESQTLEDGVVVPLGKPVE
RSCPKGMLLYNEYIVYNVEQIKMRYVIQVKFNYKR
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaagctcaaagtcgatgaactccgttcaaaactcgccgagcgtggactcagt
actaccggagtcaaagccattctggtagagaggcttgaagaggctatcgcagaagacact
aagaaggaagaatcgaagaacaaggggaaaaggaaccgagattcttcggatgatactgat
gaatcgaacaaattgattgcgattggcgaatttcgtgggatgattgtgaaggagttgcga
gaggaagctattaagagaggcttagatacaacaggaaccaaaaaacaacttcttgagaga
ctctgcaatgacgttaataacgactccaaagcaccaatcaaatcggggacagaggaagct
gaagatgacaaaaatgggtttgatgaagaaaataaagaagagaaaattgtaacagcgaca
aagaagggtgcagctgtattggatcaatggattcctgatcagataaagagccagtaccat
gttctacaaagaggtgatgatgtttatgatgccatcttaaatcagacaaatgtcagggat
aacaataacaaattctttgccctacaagttctagagtcggatactaaaaagacatacatg
gcttacactagatggggaagagttggtgtgaaaggacaaagtaagttagatgggcctttt
gactcatgcgatcgtgcaatagaaatatttaccaataagttctgtgacaagacaaagaat
tattggtctgatagaaaggaatttatttctcatcccaagtcctatacatggcttgaaatg
gattacggaaaagagaatgattcatcggtcaatgatattcccaattcatcttccgaagtt
aaacctgaaaattcaaaactagatagtcgggttgccaagttcatttctcttatatgtaat
gtcagcatgatggcacagcacatgatggaaataggatataacgctaacaaattgccactt
ggtaagataagcaagtccacaatttcaaagggttatgaagtgttgaagagaatatcagag
gtgattgagcggtttgatagacagaggcttgaggaactgagtggagagttctatactgtg
ataccacatgattttggttttaagaaaatgagtcagtttgttatcgacactcctcaaaag
ttgaaacagaaaatagaaatggttgaagcattaggtgaaattgaacttgctacaaagttg
ttgtcggtcgacccaggattgaaggatgatcctttatattatcactaccagcaacttaat
tgtggtttgacgccagtaggagccgattcagaagagttctctatggttgccagctacatg
gagaacactcatgcaaaaacgcattcgggatacacagttgagattgctcaactatttaga
gcttcaagaggtgttgaagctgaaagattccaacagttttcaaattcgaagaacaggatg
ctactctggcatgggtcacgtctcactaactgggccgggattttatctcaaggtctccgg
atagctcctcctgaagcgcctgtaactggttacatgtttggtaaaggggtttactttgct
gatatgttctccaagagcgcgaactattgctatgctaaccacggtgctaatgatggcgtt
ctactcctctgtgaggttgctttgggagacatgaatgaactcctatattcagattataac
gcggataatttacccccggggaagctaagcacaaaaggtgtggggaaaacagcaccaaac
ccatccgagtctcaaacactagaagacggtgttgttgttccacttggcaaaccagtggaa
cgttcatgccccaaggggatgttgttgtacaacgaatatatagtgtacaatgtggaacaa
atcaagatgcgttatgtgatccaagtcaaattcaactacaagcgctaa

DBGET integrated database retrieval system