KEGG   Capsella rubella: 17884069Help
Entry
17884069          CDS       T02984                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 40
Organism
crb  Capsella rubella
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 17884069
NCBI-ProteinID: XP_023636128
Position
Unknown
AA seq 236 aa AA seqDB search
MVINIFVFVSLIIVFARRRKSYKNTINEYPVSDEQSMLRFSLDEDKRALLTWEVRFRIIE
GIARGLLYLHEDSQLKIIHRDLKLSSILLDAEMNPKFSDFGTARLFETDVTRAETRRIAG
TRGYMAPEYLKHGQISAKSDVYSFGALLLEMKETIASKDKGLAAFAWKRWVEGKPESIID
PFLIEDPRNKIVKMIQIGFDTIIIPLPNAHVFSGSESQSKSGTMSMSNIFTELGCR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggtcataaatatctttgtatttgttagtctcatcatcgtttttgctcggaggagaaag
tcctacaagaacaccatcaatgagtaccctgtttctgatgaacaatctatgttgcggttt
agtcttgatgaagataagcgtgcacttcttacatgggaggtgaggttcagaattatcgaa
ggcattgctcgaggtcttctttaccttcatgaagattctcagctgaagattattcaccga
gacttgaagttgagcagcatacttttagatgctgagatgaaccctaaattttcagacttt
gggacagcccggttgttcgaaaccgatgtgactcgagctgaaacaagacgaattgctgga
acccgtggatacatggctcctgagtacctaaaacatgggcaaatctcagccaaatctgac
gtttatagcttcggtgcattgcttctagagatgaaagaaacaatagcttcgaaggacaaa
ggacttgctgcttttgcatggaagagatgggttgaaggaaagcctgagagtataattgat
cctttcttgatagaggatccaagaaacaagatcgtcaagatgatccagattggttttgat
actatcatcattccattacctaatgctcatgttttcagtggaagtgaatcccaatctaaa
agtggtacaatgtcaatgagcaatatcttcacagagttgggttgtcgttga

DBGET integrated database retrieval system