KEGG   Capsella rubella: 17884077Help
Entry
17884077          CDS       T02984                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
crb  Capsella rubella
Pathway
crb00020  Citrate cycle (TCA cycle)
crb00640  Propanoate metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    17884077
   00640 Propanoate metabolism
    17884077
Enzymes [BR:crb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     17884077
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     17884077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 17884077
NCBI-ProteinID: XP_006288023
UniProt: R0FG51
Position
Unknown
AA seq 343 aa AA seqDB search
MSRQITRLLGSLRRSCGGGSSEVVPSCCSLTSLTQSRSFGTTPPPPAAVFVDKNTRVICQ
GITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVP
APFAAAAIMEGIAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPGEC
KIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE
KFFVDPQTEGIILIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIV
SGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFEIFQERGLLK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggcagatcacgagacttctcggatctcttcgccgttcctgtggtggcgggagc
tcagaggtggttccgtcatgctgctctctcacttcgttgactcagtctcgctccttcggg
acgactcctccgcctcctgcggctgtctttgtcgacaaaaacacccgtgtcatctgccaa
ggtattaccggaaagaacgggaccttccacactgagcaagctattgaatacggaaccaaa
atggtagcaggagtgacaccaaagaaaggtggaacagaacatttaggtctccctgttttt
aataccgttgccgaagctaaagccgagactaaagccaatgcctctgtgatttacgttcct
gcgcctttcgctgctgctgctatcatggaaggcattgctgctgagttagatcttattgtc
tgcattacggaagggatccctcaacatgacatggttcgtgtaaaggccgctcttaacagt
caatcaaaaactaggctgattggccctaattgtcctgggattatcaaacctggtgaatgc
aagattgggatcatgccgggatacatccacaagcctggaaagatagggattgtttctcga
tctggaacgttgacatatgaagctgttttccaaactactgcagtaggtcttgggcaatct
acgtgtgtaggaattggtggagatccttttaacggcacaaattttgttgactgcttggag
aagttcttcgttgaccctcaaacagaaggtatcattctcattggagaaatcggtggtact
gcagaagaagatgctgctgctttgataaaggaaagtggtacagacaagcctgtagttgct
ttcatcgctggacttactgcaccacctgggcgtcggatgggtcatgcaggagccattgtt
tctggtggtaagggcactgctcaagacaagataaagagcctaagagacgctggagttaag
gtggttgaatcgccggctaagattggtgcggcgatgtttgagattttccaagaaagaggt
cttttgaagtga

DBGET integrated database retrieval system