KEGG   Capsella rubella: 17885353Help
Entry
17885353          CDS       T02984                                 

Definition
(RefSeq) cyclin-dependent kinase B1-1
  KO
K07760  cyclin-dependent kinase [EC:2.7.11.22]
Organism
crb  Capsella rubella
Brite
KEGG Orthology (KO) [BR:crb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:crb01001]
    17885353
Enzymes [BR:crb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     17885353
Protein kinases [BR:crb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   17885353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 17885353
NCBI-ProteinID: XP_006293281
UniProt: R0H9W3
Position
Unknown
AA seq 309 aa AA seqDB search
MEKYEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLST
SIYVVRLLCVEHVHQPSTKSQSPKSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQ
KLMFQLCKGVAHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIV
TLWYRAPEVLLGSTHYSTGVDMWSVGCIFAEMVRRQALFPGDSEFQQLLHIFRLLGTPTE
QQWPGVSTLRDWHVYPKWEPQDLTLAVPSLSPQGVDLLTKLLKYNPAERISAKTALDHPY
FDSLDKSQF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtacgagaagctagagaaggtcggagaaggaacgtacggaaaagtctataaa
gcgatggagaaaggcactggtaagctcgtagctctgaagaaaactcgtctcgaaatggac
gaagaaggtatcccacccaccgctcttcgtgagatctcgcttctccagatgttatctaca
tcgatctatgttgttcgattgctctgcgtcgaacacgttcatcagccttcaaccaaatcc
caatcccccaaatccaatctctatctcgttttcgagtatctcgacactgatcttaagaaa
ttcatcgattcgtatcggaagggacctaatcctaagcctcttgagccttttctgattcag
aagttgatgtttcagctttgtaaaggagttgctcattgtcatagccacggtgtgcttcac
cgtgatcttaaaccgcagaatcttcttctggtgaaagataaagagcttcttaagattgct
gatctgggtcttggtcgtgcttttactgttcctcttaagtcgtatacgcatgagattgtt
actctttggtatagagctcctgaagttcttcttggatccactcactattcaactggtgtt
gacatgtggtctgttggttgcatatttgctgagatggttaggaggcaagctctcttccct
ggtgattctgagtttcagcaattgcttcatatcttcaggctgctaggaacaccaaccgag
cagcaatggccgggtgtttccactctccgtgactggcatgtctaccctaagtgggagccg
caagacttaactcttgctgttccttctctttcacctcaaggagttgatcttctcacgaaa
ttgctcaagtacaatccagccgaaagaatttcagcaaaaacagctcttgatcatccatat
tttgatagccttgacaagtctcagttctga

DBGET integrated database retrieval system