KEGG   Capsella rubella: 17885553Help
Entry
17885553          CDS       T02984                                 

Definition
(RefSeq) autophagy-related protein 18a
  KO
K22991  WD repeat-containing protein 45
Organism
crb  Capsella rubella
Brite
KEGG Orthology (KO) [BR:crb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:crb04131]
    17885553
Membrane trafficking [BR:crb04131]
 Autophagy
  Other autophagy associated proteins
   Others
    17885553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nucleoporin_N Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 17885553
NCBI-ProteinID: XP_006291167
UniProt: R0HG43
Position
Unknown
AA seq 435 aa AA seqDB search
MATVSSSWPNPNPNPDSTSASDSDSTFPSHRDPGDDTESLDSFSSMSLNSDEPNHNSDRI
PNSNRGVSINQPPISPSLPVTPPPSVLHLSFNQDHACFAVGTDRGFRILNCDPFREIFRR
DFDRGGGVAVVEMLFRCNILALVGGGPDPQYPPNKVMIWDDHQGRCIGELSFRSDVRSVR
LRRDRIIVVLEQKIFVYNFSDLKLMHQIETIANPKGLCAVSQGVGSMVLVCPGLQKGQVR
IEHYASKRTKFIMAHDSRIACFALTQDGHLLATASSKGTLVRVFNTVDGTLRQEVRRGAD
RAEIYSLAFSSNAEWLAVSSDKGTVHVFGLKVNSGAQVKETSRIASDLTRSTSSPSSSLS
LFKGVLPKYFSSEWSVAQFRLVEGTQYIAAFGHQKNTVVILGMDGSFYRCQFDPVNGGEM
TQLEYHNCLKPPSVF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgtctcctcctcctggccgaaccccaaccctaatcccgattccacatctgcc
tcagattccgattctacttttccctctcaccgcgatcctggagacgacaccgagtctctc
gattccttctcctccatgagcctcaactccgacgagcctaatcataattctgatcggatt
cccaattccaatcgcggcgttagtattaatcaacctcctatttctccctctttaccggtg
acgcctcctccatccgtgctccacctctccttcaaccaggaccatgcttgcttcgctgtt
ggcaccgatcgtggcttccggatccttaattgcgatcccttccgtgagatttttcgccgt
gatttcgatcgtggcggtggtgttgccgtggttgagatgcttttcagatgcaacatttta
gcactcgtaggtggcggacccgatcctcagtatcctcctaataaggtcatgatttgggat
gatcaccagggacgatgtatcggagaactctctttcaggtccgatgttcgatccgtccgg
cttaggagggatcgtattattgtcgttctggagcagaagatttttgtttacaacttctcc
gacctcaagctgatgcatcagattgagaccattgcaaatcctaagggtttgtgtgctgtt
tctcagggtgttggttctatggttttggtctgtccaggtttgcagaaaggccaagttcgg
atcgagcattatgcttctaaacgcaccaagttcatcatggctcatgattccagaattgct
tgcttcgctctcacgcaggatgggcacttgttggccacagccagctctaagggtactctg
gttcgggtgttcaatactgttgatggcaccttgcggcaagaggttaggagaggtgcagat
agagcggagatctatagtttggccttctcttcaaatgccgagtggttagcagtctcaagt
gacaaaggaactgtccatgtttttggtctcaaagtcaactctggagctcaagtgaaagag
acatcacgtattgcatctgatcttactcgctccacttcatccccatcgtcgtctctatca
ttattcaaaggagtgttgccaaagtatttcagttcggagtggtcggtggctcagttccgg
ttggttgaaggaactcagtacatagccgcctttggtcatcagaagaacacagttgttatt
cttggcatggatgggagcttctacagatgccagtttgatccggtgaacggcggagaaatg
actcagcttgagtatcacaactgcctgaaaccgccctctgttttctag

DBGET integrated database retrieval system