KEGG   Capsella rubella: 17885764Help
Entry
17885764          CDS       T02984                                 

Definition
(RefSeq) glutathione S-transferase Z1 isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
crb  Capsella rubella
Pathway
crb00350  Tyrosine metabolism
crb01100  Metabolic pathways
Module
crb_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    17885764
Enzymes [BR:crb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     17885764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 Tom37 GST_N_4 GST_C_2
Motif
Other DBs
NCBI-GeneID: 17885764
NCBI-ProteinID: XP_023637918
Position
Unknown
AA seq 227 aa AA seqDB search
MANSGAEKLKLYSYWRSSCAHRVRIALTLKGIDYEYIPVNLLKGDQFDPVYRFDSRDFKK
INPMGTVPALVDGGVVINDSFAIIMYLDEKYPEPPLLPRDLHKRAVNYQAMSIVLSGIQP
HQNLAVIRYIEEKVNAEEKTSWVNNAINKGFTALEKLLVSCAGKHATGDEIYLADLFLAP
QIHGAINRFQINMEPYPTLAKCYESYNDLPVFQNALPEKQPDAPSTI
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattctggcgcagagaagttgaagctctattcttactggagaagctcgtgtgct
catcgcgtccgtatcgccctcactttaaaagggattgattatgagtatataccagtgaac
ttgctcaaaggggatcaattcgatccagtttatcgttttgattctcgagatttcaagaaa
atcaatccaatgggtactgtaccagcgcttgttgatggaggtgttgtcattaatgattct
tttgccattataatgtatctggatgagaagtatcctgagccacctctgttacctcgtgac
ctccataagcgggcggttaattaccaggcaatgagtattgtcttgtctggcatacagcct
catcaaaatctggctgttattaggtatatcgaggagaaggtaaatgcggaggagaaaact
tcttgggttaataacgctatcaataaagggttcacagctctcgagaagctattggtgagt
tgcgctgggaaacatgccactggtgatgaaatttacctggctgatctctttctagcacca
cagatccatggagcaatcaacagattccagataaacatggaaccttacccaactcttgca
aagtgttacgagtcatacaatgatcttcctgtttttcaaaatgctctcccagagaagcag
ccagatgctccttccaccatctga

DBGET integrated database retrieval system