KEGG   Capsella rubella: 17886562Help
Entry
17886562          CDS       T02984                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 5 isoform X1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
crb  Capsella rubella
Pathway
crb00520  Amino sugar and nucleotide sugar metabolism
crb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    17886562
Enzymes [BR:crb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     17886562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 17886562
NCBI-ProteinID: XP_006291434
UniProt: R0FP86
Position
Unknown
AA seq 341 aa AA seqDB search
MASSDKQTSPKPPPSPSPLRNSKFCQSNMRILISGGAGFIGSHLVDKLMENEKNEVIVAD
NYFTGSKDNLKKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTN
VIGTLNMLGLAKRVGARILLTSTSEVYGDPLIHPQPESYWGNVNPIGVRSCYDEGKRVAE
TLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRGEALTVQKPGTQTRSF
CYVSDMVDGLMRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPR
QRKPDITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVLKN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagtgataaacaaacaagcccaaagcctccaccttcaccttcacctcttcgt
aattccaagttttgtcagtcaaatatgaggattttgatctcaggaggagctggattcatt
ggctctcaccttgtcgataagctgatggaaaacgaaaagaatgaggtgattgttgctgat
aactatttcactggttcaaaggacaaccttaagaagtggatcggtcatccaagatttgag
ctgattcgtcacgatgtaacagagccacttttgatcgaggttgatcagatttaccatctt
gcatgtcctgcttctcccatcttttacaagtataaccctgtgaagacaatcaagaccaat
gtgattggcacactgaacatgctaggtctagccaagcgtgttggagcaagaattttgctt
acctcaacctcggaggtgtatggagatcctctgatccatccccagcctgagagctattgg
ggaaatgtcaacccaattggggttagaagctgttatgatgaaggcaagcgtgtggctgag
accttgatgtttgactaccacaggcagcatggaattgaaatccgcattgccagaatcttc
aacacttatggtccacgcatgaacatcgatgatggccgtgtcgtaagcaacttcattgct
caagcactacggggtgaggcattgactgttcagaaaccagggacacagactcgcagtttc
tgttatgtatctgacatggttgatggacttatgcgcctcatggaaggagatgacactggt
cccatcaacatcggtaacccaggtgagtttactatggtggaactggctgagacagtgaag
gagctgattaacccgagcattgagataaagatggtcgagaacacaccagatgatccaaga
cagaggaagccggacatcacaaaggctaaagaagtgttgggatgggaaccaaaggtgaag
ctccgtgaaggtcttcccctaatggaagaagacttcaggctaaggctcggagtcctcaag
aactaa

DBGET integrated database retrieval system