KEGG   Capsella rubella: 17886620Help
Entry
17886620          CDS       T02984                                 

Definition
(RefSeq) alpha-humulene/(-)-(E)-beta-caryophyllene synthase
  KO
K14184  alpha-humulene/beta-caryophyllene synthase [EC:4.2.3.104 4.2.3.57]
Organism
crb  Capsella rubella
Pathway
crb00909  Sesquiterpenoid and triterpenoid biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    17886620
Enzymes [BR:crb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.57  (-)-beta-caryophyllene synthase
     17886620
    4.2.3.104  alpha-humulene synthase
     17886620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth Arena_nucleocap
Motif
Other DBs
NCBI-GeneID: 17886620
NCBI-ProteinID: XP_006292580
UniProt: R0HNK1
Position
Unknown
AA seq 558 aa AA seqDB search
MELKNHVSVARSEEVKRPLADFPVNIWEDPLTTFSVLDLDSEKNKEKLLSLKEKVMESFM
ASRQNPIENIKLIDALCRLGISYHFEREIFMQLETIFGSHDFMQMIIDNESSLYTVGLVF
QIFRQFGYKFTTDVFEKFKNKDGKFEDCLAEDAKGVLCLYEAAHWSTHGEDMLDEALTFS
RSILEEIASRSSDPHHLTVRIKNALKHAYPRGISRIETRQYISYYEKEDSHDQTLLEFAK
VDFNLLQVLYREELGQVFRWYNNLNLESKLPYARNRTVESYLWAVGAHFEPCYSQARIIF
AKLIIVLTLVDDTYDAYGTIQELEPFTDALLRWNPSGIEGLPESMKYIHRVVLEFFDKLE
KDMEKEGRPGYGLYAKQSMQVTAKSYIQEAKWLNQDYVATFDEYKENGVYSASFLALSTV
SFLGKVDEVTLDVLEWLNTFPPLLVSSSLIGRFCNDIASCEFEHKRKHIVTSIDCYMKQY
GVSWEKATEEIKVMASDSWKTLNQELMMKPHQFPFSVVMRFLNLSRVMEVFYKKTDIFTQ
PELMKDYVVSLFLNKIPI
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaaaaatcatgtatccgtggccaggagtgaggaggttaaacggcctttagcg
gattttcccgttaatatatgggaagatcctttgacaactttctcggttctcgatctggat
agtgagaaaaacaaggagaagctgctttcactcaaggaaaaagtgatggaatcgttcatg
gcttcaagacaaaatcctattgagaacatcaaactcattgatgctctttgtcgcctcggt
atctcctatcactttgaacgtgaaatcttcatgcagctggagacgatatttggctctcat
gatttcatgcagatgataatagacaacgagtccagtttatacactgttggtcttgtcttt
caaatttttaggcagttcggctataaattcactaccgatgtgtttgaaaagttcaagaac
aaggatggtaagtttgaggattgtctagccgaggatgcaaaaggtgtgttatgcctttat
gaagctgcccattggagcacccatggcgaagatatgcttgacgaagctctcactttctct
aggtctattttggaagaaattgcttctcgatctagtgatcctcatcatctcacagttcgc
atcaagaatgccctcaagcatgcatatcctaggggtatctcaaggatagagacaagacaa
tatatctcatactatgaaaaagaagattcccacgatcaaactttgcttgaatttgctaag
gtagattttaatctacttcaagtgttataccgcgaagagcttggccaagtctttaggtgg
tacaataatctaaacctcgaatcaaaattgccgtatgcaaggaataggacggttgaaagc
tacttgtgggcagttggagcacactttgaaccatgttattcgcaagcaaggattatattt
gccaaactaataattgttttgacactagttgatgatacatatgatgcttatggcacgatt
caagagcttgaaccatttacagatgcgttgttacggtggaaccctagtggtattgaaggt
ctcccagagagcatgaaatacattcaccgtgttgtgttagagttctttgacaaactcgag
aaggacatggagaaggaaggaaggccaggatatggcctctatgcaaaacaatcgatgcaa
gtaacggctaagtcctatattcaagaggcaaaatggttgaatcaagactacgtggccaca
tttgacgagtacaaagaaaatggagtttactcggcgagttttttggcattgtcaacagta
tcctttctaggaaaagtggatgaagtcacacttgatgtgcttgaatggttaaacactttc
ccaccacttctagtgtcttcgtcgttgataggccgcttttgtaatgacattgcaagctgc
gagtttgagcataaaagaaagcatatagtgacatccattgattgttatatgaaacaatat
ggtgtttcatgggagaaagccacagaagaaatcaaagtcatggcatctgactcatggaag
actcttaaccaagaactgatgatgaagcctcaccagtttcctttctctgtcgtcatgcga
tttctaaacctctcgagggtcatggaggttttctacaagaagactgacatattcacgcaa
cctgagttgatgaaagattatgtggtttctttgttcctcaacaaaatacccatatga

DBGET integrated database retrieval system