KEGG   Capsella rubella: 17886679Help
Entry
17886679          CDS       T02984                                 

Definition
(RefSeq) glutathione S-transferase L2, chloroplastic
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
crb  Capsella rubella
Pathway
crb00480  Glutathione metabolism
crb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    17886679
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:crb02000]
    17886679
Enzymes [BR:crb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     17886679
Transporters [BR:crb02000]
 Other transporters
  Pores ion channels [TC:1]
   17886679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C_5 GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 17886679
NCBI-ProteinID: XP_023638553
Position
Unknown
AA seq 294 aa AA seqDB search
MSVGVNVSVCSYSSLALSTKDFSSISSSSLSLDRNILRPVSGRLRCKSSGKRRIEPILAV
KESSRVPELDSSSEPVQVFDGSTRLYISYSCPFAQRAWIARNYKGLQNKIELVPIDLKNR
PAWYKEKVYAANKVPALEHNNRVIGESLDLIKYIDTNFEGPSLTPDGLEKQAAADELLSY
TDSFSKAVRSTLNGTDSNAADATFDYIEQALSKFNEGPFFLGQFTLVDVAYAPFIERFQL
ILRDVTNVDITSGRPNLTLWIQEMYKIEAFTETRQDPKELVERYKKRVQAEARL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcggagttaatgttagcgtgtgctcatattcatcgcttgcgctgtccactaag
gacttctcctctatctcctcgtcttccctctctcttgatcgaaatattctccgaccagtc
tccggcaggctaaggtgtaaatcctctgggaaacgtagaatcgaaccaatattagctgtt
aaagaatcgagtcgagtaccggagcttgattcttcttcggagccagttcaagtgttcgat
ggatcaactaggttgtacatatcttactcttgcccatttgctcagcgtgcgtggattgct
cgcaattacaagggtctacaaaacaagatagaacttgtaccaattgatctcaaaaacagg
cctgcttggtataaggagaaagtttacgccgcaaacaaggtgcccgcattagagcacaat
aaccgagtaattggagagagccttgatctgattaagtacattgacaccaattttgaaggg
ccttcacttacccccgatggtttagagaagcaagcagcagctgatgagttgctctcctac
actgactccttctccaaggctgtgagatccacattaaacggcactgacagtaatgcagca
gatgctacatttgattacatcgagcaggcactttccaaattcaatgaaggccctttcttc
cttggccaatttactttggtcgatgttgcatatgctccattcatagagagatttcagctt
atcttaagggatgtaacgaatgtggatatcacatctggtcggcctaacctcaccctttgg
attcaggagatgtacaagatcgaagctttcactgaaacccgtcaagatccgaaagagcta
gttgaaagatacaaaaaacgagttcaagcagaagcacgactttaa

DBGET integrated database retrieval system