KEGG   Capsella rubella: 17886814
Entry
17886814          CDS       T02984                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
crb  Capsella rubella
Pathway
crb00100  Steroid biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
Module
crb_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    17886814
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     17886814
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 17886814
NCBI-ProteinID: XP_006291213
UniProt: R0FPT7
Position
Unknown
AA seq 374 aa
MLLDMDLGVLLSSLIPSFQSVYVLVFYFVYLAVAGEILPGKVIRGALLSDGSQLRYRCNG
LLALTLLVAILGICAKLGIVSPLVVADRGLELLSATFILCVLVTLALYITGRSSSDKSSS
LKPHVSGNLVHDWWFGIQLNPQFLSIDLKFFFVRAGMMGWLLINLSILAKSVQDDSLSQS
MILYQIFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSIQGWWLLHNN
KVELTVPAIVANCLVFVIGYLVFRGANKQKHIFKKNPKTPIWGKPPVVVGGKLLASGYWG
IARHCNYLGDLMLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEVRCAEKYKEIWAE
YLRLVPWRILPYVY
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgctcctagatatggatctcggtgttcttctatcatctcttattccttcatttcaatct
gtttatgtgctggtgttttacttcgtttacttggccgtcgccggagaaattctccctggg
aaagttattcgcggcgcacttttatcagatggctctcaacttcgttaccgatgcaatggt
ctattggcgttaacactgttggtcgctattttgggaatctgtgcaaaacttggcattgta
tcacctcttgtggttgcggatagaggacttgagttactctcagctacttttattctctgt
gttttggtgacattagcattgtatattactgggcgaagttcctcggataagagttcttcc
ctaaagcctcatgtctcaggaaatcttgtacatgactggtggtttggaatacagctgaat
cctcagtttctgagcatcgatctcaagtttttctttgtcagagccgggatgatgggatgg
ctgcttatcaatctctctattttggcgaaaagtgtgcaggatgattcactgagtcagtcg
atgattctttaccagatcttctgtgcgttatatatattggactactttgttcatgaagaa
tacatgacctctacatgggatataattgcagagagactgggcttcatgttagtctttgga
gatctcttgtggattcctttcacttttagcattcagggctggtggttgttgcacaacaac
aaagtagaactaacagttcctgctattgtagccaattgccttgtcttcgtgatagggtac
ttggtttttcgaggggctaacaaacaaaaacatatctttaagaagaacccaaaaacacct
atatggggcaagcctccagtggtagttggtggaaagttactggcttcaggctattgggga
attgcaaggcactgtaattatcttggggacttgatgctcgctctctccttcagtttgccc
tgtggaataagttctccagtgccatatttctacccaatatatcttctgatactgttgata
tggagagaacgaagagatgaggttagatgtgcagagaagtacaaagagatctgggcagag
tatcttagacttgtcccgtggagaatacttccttatgtttattag

DBGET integrated database retrieval system