KEGG   Capsella rubella: 17887139Help
Entry
17887139          CDS       T02984                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
crb  Capsella rubella
Pathway
crb03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:crb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    17887139
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:crb03041]
    17887139
Enzymes [BR:crb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     17887139
Spliceosome [BR:crb03041]
 Complex C
  Other components
   Step II factors
    17887139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Sigma54_activ_2 AAA_16 PhoH Flavi_DEAD ABC_tran
Motif
Other DBs
NCBI-GeneID: 17887139
NCBI-ProteinID: XP_006290254
UniProt: R0FL16
Position
Unknown
AA seq 1174 aa AA seqDB search
MEKEELNKLNHLSLVSNVCNELETHLGSAEKVLAEFIIDLGRHSETVDEFDKKLKDEGAE
MPDYFVRSLLTVIHAIYPPKPKSEKKKDEGEDVKFKGLAIKDTKDKVKELEKEIEREAEE
RRREEDRNRDRERGRDRRDSGRDRDRDRDRNRDDRRDRHRDRERYRGDEEGEDDRRSDRR
HRERGRGDDEGEDRRRDRRAKDEYVEEDRGGAIANEPELYQVYKGRVTRVMDAGCFVQFD
KFRGKEGLVHVSQMATRRVDKAKDFVKRDMEVYVKVISITNDKYSLSMRDVDQNSGKDLI
PLRKPSDEDDSSRSNPSYRTKDGQVTKTGISGIRIVEENDVAPSRRPLKKMSSPERWEAK
QLIASGVLKVDEFPMYDEDGDGMLYQEEGAEEELEIEMNEDEPAFLQGQTRYSVDMSPVK
IFKNPEGSLSRAAALQSALTKERREMREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQ
ELRGVGLSAYDMPEWKKDAFGKTPTFGQRSKLSIQEQRESLPIYKLKKELIQAVHDNQVL
VVIGETGSGKTTQVTQYLAEAGYTTKGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGY
AIRFEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVIMLDEAHERTIHTDVLFGLLKKL
MKRRLDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPETDYLDAALITV
LQIHLTEPEGDILVFLTGQEEIDSACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRI
FDPPPPGKRKVVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPISQASA
KQRAGRAGRTGPGKCYRLYTESAYRNEMPPTSIPEIQRINLGMTTLTMKAMGINDLLSFD
FMDPPQPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLEPPLSKMLLASVDLGCSDE
ILTMIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFE
NFIQSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTKIRKAITAGFFFHGARKDPQEGY
RTLVENQPVYIHPSSALFQRQPDWVIYHDLVMTTKEYMREVTVIDPKWLVELAPRFFKVS
DPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagaagagcttaacaaattgaatcatctctctctcgtctccaatgtctgtaac
gagttagaaacccatctaggatctgcggagaaagttttggcagagttcatcatcgatctc
ggtcgtcactctgagactgtagatgaattcgataagaagcttaaggatgaaggtgcggag
atgccggattacttcgtccggtcgttgttaactgtaatccacgcgatttatcctccgaag
cccaagtctgagaagaagaaagatgaaggtgaggatgttaaattcaaaggtttagcgatt
aaggatactaaggataaagttaaggagcttgagaaggagattgaaagagaagctgaggag
cgtcggagagaggaggatcggaatagggatagagagaggggacgggatcggagggattct
ggtagagatagggatagagatagagataggaatcgtgatgatagaagggatcgacatagg
gatagagagagataccgtggagatgaggaaggtgaagatgacagaagaagtgataggagg
catagagaaagaggtcgtggtgatgatgaaggggaagataggcgtagagatagacgtgct
aaggatgagtatgtggaggaagatagaggtggtgcgattgcgaatgagcctgagttgtat
caggtatataaagggagggttactagggttatggatgcgggatgttttgttcagtttgat
aagtttagaggaaaagaaggtcttgttcatgtttctcagatggctactagaagggttgat
aaggctaaggattttgtcaaacgggatatggaggtttatgtgaaagtgatatctattacg
aatgataagtatagtctttctatgagagatgttgatcagaattcgggaaaagatttgatt
cctctgaggaagccttcagatgaagatgattcatccaggagtaatccttcatatagaaca
aaggatggacaagtaacgaagactgggatttctggaatccggattgtggaggagaatgat
gttgcgccttcacgcaggccgttgaagaagatgagctctcctgagagatgggaagcgaag
cagttgattgcttctggtgtcttgaaagttgatgagtttccgatgtatgatgaggatgga
gatgggatgctttatcaagaggaaggtgctgaagaagaacttgagattgagatgaatgaa
gacgaacctgctttcttacaagggcaaactaggtactctgttgacatgtctcctgttaag
atcttcaaaaatcctgagggttcgttgagtcgcgcagctgcacttcagtccgccctcacc
aaggagaggagagaaatgagagaacagcagcaaagaacaatgcttgactctatccccaag
gatctgaatcgtccatgggaagaccctatgcctgaaactggtgaaaggcatctggctcaa
gagcttaggggtgttgggttatcagcttatgacatgcctgagtggaagaaggatgccttt
ggaaaaactccaacttttggacagagatcaaagctttctattcaggaacaaagggagagc
cttccgatttacaagttaaaaaaagagcttatacaggctgtgcatgataatcaagttttg
gtggtcattggtgagactgggtctggaaagacaacacaggtaactcaatatcttgctgaa
gcaggttacacaacaaagggaaagattgggtgtactcagcctcgtagggttgctgctatg
tctgttgctaagagagtagctgaggaatttggttgtcgtttaggagaggaggtagggtat
gcgattcggtttgaggattgtactggaccagacacagtgatcaagtacatgactgatggt
atgcttcttagggagattttgatagatgaaaacctttctcaatattctgtaatcatgctt
gatgaagctcatgagcggacaatccacactgatgtgctgtttggtcttctaaagaagctg
atgaaacgtcgtcttgatcttcgtctgattgtcacgtctgccacgttggatgcagaaaag
ttctctgggtatttcttcaactgcaacatttttaccattcctggaagaacctttcctgtt
gagattttgtataccaaacagccagaaacagattacttggatgcagccctgatcacagtt
ctgcagattcacttgactgaacctgagggtgacattctcgtctttttgacaggacaggaa
gaaattgattctgcatgtcaatctctgtacgagagaatgaaaggtctaggtaaaaatgtt
cctgaacttatcatacttccagtttacagtgcccttcctagtgagatgcagtctagaatt
tttgatcctccccctcctggtaaacggaaagtggttgtagctacaaatattgcagaagct
tcgttaacaatagatggtatatactatgttgttgatcctgggtttgcaaagcagaatgtg
tataatccaaagcaagggctggaatcgctagtcattactccaatttcacaggcatcggca
aagcaaagagctggacgtgctggtcgtactgggcccgggaaatgttaccgtctctacaca
gagagtgcatatcgtaatgagatgcctcctacatcaatccctgaaattcaaagaatcaat
cttggaatgacaactttaaccatgaaagccatgggcattaacgacctgttatcatttgac
ttcatggatccacctcaaccacaagcattgatctctgcaatggaacagttgtacagcctg
ggagctttggatgaggaaggtttgttgacgaagcttggtagaaaaatggcggagtttcct
cttgaaccgccgctctctaaaatgttgctagcaagtgtggatctcgggtgcagcgatgag
attttaacaatgattgctatgatccagacaggcaacatattctatagaccaagggagaag
caagctcaagcagaccaaaaacgggcaaagtttttccagcctgaaggtgatcacttgaca
ttgctggctgtatatgaggcttggaaggcaaaaaacttttcaggtccatggtgttttgaa
aacttcatacagtcaagatcgttacgacgtgctcaagacgtaaggaaacaacttctcagc
attatggacaaatataaactagatgtggtaagtgcggggaagaatttcacgaagataagg
aaagcaataacggcaggcttcttcttccatggagcaagaaaagatccacaagaaggttac
aggacactggtggagaatcaaccggtgtatattcacccgagcagcgcgctgttccagaga
caaccagactgggttatatatcacgatcttgtgatgacgaccaaagagtacatgagggaa
gtaacagtgattgacccaaagtggcttgttgagttagctccaagattcttcaaagtctct
gacccaacgaaaatgagcaagcgcaagcgccaagaacggattgagcctttgtatgaccgt
taccacgagcctaactcatggcgtctcagcaaaagacgtgcttga

DBGET integrated database retrieval system