KEGG   Capsella rubella: 17887860Help
Entry
17887860          CDS       T02984                                 

Definition
(RefSeq) bifunctional dihydrofolate reductase-thymidylate synthase 2
  KO
K13998  dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
crb  Capsella rubella
Pathway
crb00240  Pyrimidine metabolism
crb00670  One carbon pool by folate
crb00790  Folate biosynthesis
crb01100  Metabolic pathways
Module
crb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    17887860
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    17887860
   00670 One carbon pool by folate
    17887860
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     17887860
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     17887860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylat_synt DHFR_1
Motif
Other DBs
NCBI-GeneID: 17887860
NCBI-ProteinID: XP_006294113
UniProt: R0FWL1
Position
Unknown
AA seq 483 aa AA seqDB search
MATGEALCNNVQSTVSVTRRSYQVVIAATRDMGLGMDMKLPWDLPMEYEFFQGVTTKTSD
PKKRNATIMGRKTWDSTPLEFRPLLGRLNVVLTSSSCLDIGADDNVLVCSTMESALELLA
TAPYSLSIETVFVIGGGELLRNYMNAPDCEAIHLTEIDISVPCDAFAPRVDTSLYHPWYS
SFPRMENGTRYSFNTYVRRKNHIFGSGEKKSVVGSDFKQYYSFLPKMVFERHEEFGYLNL
VQNIISTGDMNDNTTLSKFGCQMRFNLRKTFPLLTTKKVFWLGVVEETLQLISGSTNPKE
KGNNHIWDSDEAKEYINSFRENATEEEVDNPLQWRNSDSSKEFNQLSDVINKIKNNPHKQ
KIMLSTYNLKLSVSPCQTVAQFYVANGELSCQIYQNSTEASLEIPFSIAAYSLLTCIIAH
VCDLVAGDFIHVIGQANINKTHVQNIQKQLQISPIPFPILKINPQKKKIDDNFEASDLEL
LKI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctactggtgaagcactgtgtaacaatgtccaaagcacagtttcagttactagaagg
agttaccaagtcgttatagcagcgacaagagacatgggtcttggtatggacatgaaactt
ccttgggatttaccaatggaatacgaatttttccaaggtgttacaactaagacatctgat
cccaagaagaggaatgcgactataatgggaagaaaaacttgggattctactcctctagag
tttcgtccccttcttggtcggctcaacgttgttcttacaagttctagctgtctcgacatt
ggcgccgatgacaatgtattggtgtgtagtaccatggaatcggctcttgaacttctagcc
acggcaccatattccttgtctattgagacggtctttgtcataggaggtggcgagttgtta
aggaactatatgaatgcaccagactgtgaagctatccacctaacagaaatcgatataagt
gtaccatgcgatgcatttgcgccgagggtggatacttctctataccatccgtggtactca
tcatttccaagaatggaaaatggaactcggtatagtttcaacacttatgtccgaagaaaa
aatcatatttttggttccggtgaaaagaaaagtgttgttggttcagatttcaagcagtac
tactcgttcttgcctaagatggttttcgaaaggcatgaggagtttggttacttgaatctt
gttcaaaacattatatctactggagacatgaatgacaatactactctttctaaatttgga
tgtcagatgcggttcaatctgcgcaagactttcccgctactcacaaccaagaaagtattc
tggctaggagtcgttgaggaaaccctacaactcatcagtggttcaaccaatcccaaggaa
aagggaaataatcatatatgggatagcgatgaggctaaagaatatattaacagtttcaga
gagaatgctacagaagaagaagtagacaacccactccagtggagaaattctgattctagc
aaagagttcaatcagctctctgatgttataaacaagataaagaacaatcctcataagcaa
aagatcatgctttcaacttacaatctgaagttgtcggtatctccttgtcagacagttgca
cagttctatgtggcaaatggtgagctctcctgtcaaatctaccagaactcaaccgaagca
agcctcgagattcctttcagtatcgctgcatattcgctcttgacatgcatcattgctcat
gtttgcgaccttgtagctggtgacttcatccatgtgattggacaagccaatattaacaaa
actcacgtccaaaacatacaaaaacagcttcaaatctcaccaatacccttcccgattttg
aaaatcaaccctcagaaaaagaagattgatgataactttgaggcttctgatttggaactc
ctgaagatatga

DBGET integrated database retrieval system