KEGG   Capsella rubella: 17887900Help
Entry
17887900          CDS       T02984                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase SRK
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
crb  Capsella rubella
Brite
KEGG Orthology (KO) [BR:crb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:crb01001]
    17887900
Enzymes [BR:crb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17887900
Protein kinases [BR:crb01001]
 Serine/threonine kinases: TKL group
  IRAK family
   17887900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Pkinase_fungal Haspin_kinase AMA-1 ABC1
Motif
Other DBs
NCBI-GeneID: 17887900
NCBI-ProteinID: XP_023640441
Position
Unknown
AA seq 445 aa AA seqDB search
MIIYQNGTLSSTCVTWSENLVDVKKYTEGGQDLYIRLYGEKKSKSRLIIGLSLGSTATVI
VIIIMLLVYIWKKKQKLARATEMDENVIMESQSEENIFGAEDIETPQLPPMDFGTILRAT
ENFSDANEIGHGGFGTVYKGRLPSGQEIAVKKLSAISRQGIVEFKTEVMLIANLQHINLV
RLVGWSVHKDERVLVYEYLENGSLQQRLFGGGQNSCELNWQTRFNIIKGIAQGLAYMQQG
SRDMIIHRDLKPGNILLDRGMVPKISDFGLARICNRREREANTTKPSGTFGYMSPEYAES
GSYSTKSDIFSFGVMLLEIVSGKENRTFSYSLCNTNLLSYMWTKWHDENWEDTVDQTIRE
YSSSIQKQQVQRCLEVGLLCVQQDAEDRPNMSSVLMMLVNDTAGIPSPKLPGFYKADGGH
NDISITSGSSSTAIKYSSSTSHLSY
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgattatctatcaaaatggtactttatcatcaacttgtgtgacttggagcgaaaaccta
gtagatgtaaaaaaatacacggagggaggtcaagatttgtacatcagactctatggagag
aagaaaagcaaaagtcggctaattataggtctgagccttggatcaacggctactgtcatc
gtcataataattatgttactagtttatatttggaaaaagaaacaaaagctagcaagagca
actgaaatggatgaaaatgttataatggaatcgcaaagtgaagaaaacatatttggagca
gaggatatagagactccgcaacttccacccatggattttggaacaatattaagagccacc
gaaaacttctcagatgctaatgagattggacatggtggattcggtactgtatataaggga
cgtttacctagcgggcaagaaattgcagtgaaaaaactatctgctatctcaagacaaggg
atcgtggagttcaaaaccgaggtgatgttaatcgcaaacctccagcatatcaatctagtt
agacttgttggctggagcgttcacaaggatgagagggtcttggtatatgaatacctagaa
aacggaagcctccaacaacgactttttggtggaggccaaaactcatgtgagctaaactgg
cagacgagatttaacataattaagggcatcgctcaaggacttgcgtatatgcaacaaggt
tcgcgagatatgattatacacagggatcttaagccaggaaacatcttgcttgatagaggt
atggtccccaaaatttcagatttcgggttggcaagaatctgtaacaggagagagagggag
gctaacacaacgaagccgtctggtacttttggttacatgtcccccgagtacgcggagagt
gggtcgtattcaacaaagtcagatatctttagcttcggtgtgatgctccttgagatcgtc
agtgggaaggagaatagaaccttttcatactcgctgtgcaacactaatcttctaagctat
atgtggaccaaatggcatgacgagaactgggaggatactgttgatcaaaccatacgagag
tactcctcatcaattcagaaacaacaagtccaaagatgtctagaagttggtctcttgtgt
gttcagcaagatgcagaggacagacctaatatgtcgtcggtgttaatgatgcttgttaat
gatactgctgggatcccgagccctaaacttcctggtttttataaggctgatggtggtcac
aatgatatttccataacgtctggttcttcatctaccgccataaaatactcctcctccaca
tcacacctcagttattaa

DBGET integrated database retrieval system