KEGG   Capsella rubella: 17891139Help
Entry
17891139          CDS       T02984                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
crb  Capsella rubella
Pathway
crb00051  Fructose and mannose metabolism
crb00520  Amino sugar and nucleotide sugar metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
Module
crb_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    17891139
   00520 Amino sugar and nucleotide sugar metabolism
    17891139
Enzymes [BR:crb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     17891139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 Fucokinase DUF4954
Motif
Other DBs
NCBI-GeneID: 17891139
NCBI-ProteinID: XP_006297815
UniProt: R0I2Y2
Position
Unknown
AA seq 406 aa AA seqDB search
MSEEKVVSVIMVGGPTKGTRFRPLSFNTPKPLIPLAGQPMIHHPISACKKISNLAQIFLI
GFYEEREFALYVSSISNELKIPVRYLKEDKPHGSAGALYHFRDRIMEEKPSHVFLLNCDV
CCSFPLQGILDAHRRYGGIGTMLVIKVSAEAASQFGELIADPDTKELLHYTEKPETFVSD
LINCGVYVFTSDIFNAIEGVYSQIRDTSSNYQSATRSVPADFVRLDQDILSPLAGKKQLY
TYENKDFWEQIKTPGKSLKCSALYLSQFRQTSPHLLASGDGTNRRPMIIGDVYIHPSAKL
HQTAKIGPNVSISANVRVGPGARLINCIILDDVEIKDNAVVINSIIGWKSSIGRWSRVQA
SGDYNERLGITILGEAVTVEDEVAVIGSIVLQNKTLNVSVQDDIIL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagaaagtcgtctctgtgatcatggttggtggtccgacgaaaggaactcgg
tttcgtcctttatcgttcaatacaccgaaaccactgattcctttggctggtcaacctatg
attcatcatcctatctctgcttgtaaaaagatatcaaatctggctcagatctttctgatt
ggattttacgaggaaagagaattcgctttgtatgtctcttcgatatctaatgagctgaaa
attccagtgcgatacttaaaagaagataagccccatggctcagccggtgctctttatcac
tttcgtgatagaattatggaagaaaaaccgtcacatgttttcctcctgaactgtgatgtt
tgctgttctttccctcttcagggcatactcgatgcacatcgaagatatggtggtatcgga
actatgctagtaattaaggtttctgcagaagcagccagccaatttggagaattgatagct
gatcctgatactaaagaactcctgcattatacagagaagcctgagacttttgtcagtgac
ttgataaactgtggtgtttatgtgtttacctcagatatcttcaatgccattgaaggagta
tatagccaaataagagacacatctagcaactatcaatctgctacaaggtctgttcctgcg
gattttgtgagattagatcaagatatattgtcacctcttgctggaaagaagcaactatac
acatatgagaataaggatttctgggaacagattaagactcctgggaaatcattgaaatgc
tcggctttatatctttcccaattccgccaaacatcgcctcatcttttggcttcaggagat
ggtactaataggagaccgatgataatcggtgatgtttatattcacccatccgcaaaactg
catcaaaccgcaaagatcggtccaaatgtatcgatctcagcaaacgttcgtgttggacct
ggtgcaaggcttatcaactgcataatcttggacgatgttgaaatcaaggacaatgctgtt
gtcataaactcaatcatcggatggaaatcatctataggtagatggtcaagagttcaagct
agtggagattacaatgagaggcttgggattacaattcttggtgaggctgtaactgtggaa
gatgaagttgcagtcataggaagcattgttcttcagaataaaactcttaacgtcagtgtt
caagacgatataatcttgtga

DBGET integrated database retrieval system