KEGG   Capsella rubella: 17892515Help
Entry
17892515          CDS       T02984                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 6, peroxisomal
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
crb  Capsella rubella
Pathway
crb00061  Fatty acid biosynthesis
crb00071  Fatty acid degradation
crb01100  Metabolic pathways
crb01212  Fatty acid metabolism
crb04146  Peroxisome
Module
crb_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    17892515
   00071 Fatty acid degradation
    17892515
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    17892515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:crb01004]
    17892515
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:crb04147]
    17892515
Enzymes [BR:crb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     17892515
Lipid biosynthesis proteins [BR:crb01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   17892515
Exosome [BR:crb04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   17892515
  Exosomal proteins of breast cancer cells
   17892515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 17892515
NCBI-ProteinID: XP_023642229
Position
Unknown
AA seq 699 aa AA seqDB search
MDSSSSAAARRRINAIHSHLVTSSRSSPLLRSNPTAGEFCLDNGYSVVLPEKLNTGNWNV
YRSAKSPFKLVSRFPDHPDIATLHDNFEHAVHDFRDYKYLGTRVRVDGTVGDYKWMTYGE
AGTARTALGSGLIHHGIPMGSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPDAVK
FIVNHATVQAIFCVAETLNSLLSCLSEMPSVRLVVVVGGLNESLPSLPASAGVKVVSYSV
LLNQGRSNPQRFFPPKPDDVATICYTSGTTGTPKGVVLTHANLISNVAGSSFSVKFFSSD
VYISYLPLAHIYERANQILTVYFGVAVGFYQGDNMKLLDDLAALRPTIFSSVPRLYNRIY
AGIINAVKTSGGLKERLFNAAYNAKKQALLNGKSASPIWDRLVFNKIKDRLGGRVRFMTS
GASPLSPEVMEFLKICFGGRVTEGYGMTETSCVITGMDEGDNLTGHVGSPNPACEVKLVD
VPEMNYTSGDQPHPRGEICVRGPIIFRGYYKDEVQTREVIDEDGWLHTGDIGLWLPGGRL
KIIDRKKNIFKLAQGEYIAPEKIENVYAKCKFVGQCFIYGDSFNSSLVAVVSVDPDVLKS
WAASEGIKYGGDLRELCNNPRVKAAVLSDMDTVGREAQLRGFEFAKAVTLVLEPFTLENG
LLTPTFKIKRPQAKEYFGEAITNMYKELGASDPTANKAL
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggattcttcctcatccgccgcagcacgccgccgcatcaacgctatccactctcatctc
gtcacgtcttctcgttcttcccctctcctccgttccaatcccaccgccggcgagttctgt
cttgataacggctacagtgttgttctccccgagaaattgaatactggcaattggaatgtc
tacagatctgcaaagtctccgttcaagctcgttagtagattcccagatcatcctgacatc
gccactcttcatgacaacttcgagcatgctgttcatgattttcgggattacaagtattta
ggaactcgtgttcgtgtcgacggcactgttggagactacaaatggatgacatacggagaa
gctggtactgcaagaactgctcttggttctggtttgattcatcacggtatcccaatggga
tcatctgttggaatctactttatcaaccgcccagagtggctcatcgttgatcatgcttgt
tcttcttattcttatgtctctgttcctttgtatgatactcttggtcctgatgctgtcaaa
tttattgtcaatcatgcaactgtgcaagccatattttgtgtggcagagactttaaactct
ttacttagctgcttgtctgaaatgccaagtgtacgactggtggtggttgttggagggtta
aatgaatctttaccctcgcttccggcatcagcaggagtgaaggttgtatcatattcggtg
ttactgaatcagggtcgcagtaaccctcagcgatttttcccaccgaaaccagatgatgtt
gcaactatatgctatacaagcggaacaactgggacacccaagggagtcgttttaactcat
gcaaacttgatttcaaatgttgctggctccagctttagtgtgaaatttttctcttcagat
gtttacatttcgtatcttccattggcacacatttacgaacgagctaatcagatcctaaca
gtgtactttggagttgctgttggattctaccaaggggacaatatgaaactactggatgat
ttggctgctctgagacctactatattcagcagtgtccctcgattatacaatagaatttat
gctggtatcattaatgcagtaaaaacctctggggggctgaaagagagacttttcaatgct
gcctataatgcaaagaagcaggctctcttaaatggaaagagtgcttcgcccatatgggac
agattggtatttaataagataaaggacagacttggaggacgggttcgttttatgacgtct
ggtgcttcacccctgtctcctgaagtgatggaatttttgaaaatatgctttggaggaaga
gttacagagggttatggaatgactgaaacatcctgtgttataactggaatggacgagggt
gataacctcactggacatgttggctctcctaatccagcttgtgaagtaaagcttgtggat
gtcccggaaatgaactatacatcaggggatcagccccatccccgtggcgaaatatgtgtt
aggggtcctatcatttttagaggctattacaaagatgaagttcaaacgagagaggtcatt
gatgaagatggatggcttcacactggagatataggtctatggctgccaggaggacgtcta
aaaattattgacaggaagaagaacatcttcaagttggcgcagggggagtatatagctcct
gagaaaattgaaaacgtctatgctaaatgcaaatttgtgggccaatgcttcatatatggt
gatagctttaattcatcattggtcgctgttgtatcggttgatcctgatgtgctgaaaagc
tgggctgcttcggaaggcattaagtatggaggagatctgagagaattgtgcaataacccg
agggtgaaagcagcagtactatctgacatggacactgttggaagagaagctcagttgaga
ggttttgagtttgcaaaggcagtgacgttggtgctagagccgtttacactggaaaatggt
ttgttaactccaacattcaagataaagagaccacaagcaaaggaatatttcggagaagca
ataacaaacatgtacaaggagcttggtgcttctgatcccaccgctaataaagctttgtga

DBGET integrated database retrieval system