KEGG   Capsella rubella: 17896695Help
Entry
17896695          CDS       T02984                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
crb  Capsella rubella
Pathway
crb00010  Glycolysis / Gluconeogenesis
crb00562  Inositol phosphate metabolism
crb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    17896695
   00562 Inositol phosphate metabolism
    17896695
Enzymes [BR:crb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     17896695
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     17896695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 17896695
NCBI-ProteinID: XP_006307357
UniProt: R0INL4
Position
Unknown
AA seq 487 aa AA seqDB search
MATKTVWIILLCLFVVSQADQGFDVRHHLSTVTRYSVSKDVTQNLIEGSNVPSECTPIHL
NLVARHGTRSPTKKRLRELENLAGRLKELVRDAEARKLPSDKIPGWLGQWKSPWEGKVKG
GELIRQGEDELYQLGIRVRERFPSLFEDDYHPDVYTIRATQIPRASASAVAFGMGLFSEK
GNLGPGRNRAFAVTSENRASDTKLRFFECCQNYKSYRKAKEPAVDKLKEPVLNKITASVA
KRYGLNFTKQDVSSLWFLCKQEASLLNVTNQSCELFTPSEVALLEWTDDLEVFILKGYGN
SLNYKMGVPLLEDVLHSMEEAIKAREEKLPPGSYEKARLRFAHAETIVPFSCLLGLFLHG
SEFEKIQKEQPLELPPQPPKTRDFRGSTMAPFGGNNILVLYSCPADSSPKYFVQVLHNEH
PIALPGCDGKDFCSLEDFKAKVLTPHLKHAFDNLCNANLDDPKQKPAPSKLSILLSWLYG
SGQDTEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaagactgtttggatcatactgttgtgtctatttgttgtttcacaggcggat
cagggtttcgatgttcgtcatcacctctccaccgtcaccagatactcagtttcgaaagat
gttactcaaaatttgattgaagggtcgaatgtacctagtgagtgtacacctatccacctt
aaccttgtggctaggcatggaactcgttctccaaccaaaaaacggttgagggaattggag
aatttggctggtaggttaaaggaactggtaagagatgcagaagctagaaaattgccttca
gacaaaattcctggatggttagggcaatggaaatctccttgggaaggaaaggtgaagggc
ggggagctgatcaggcaaggagaggacgagttgtaccaactgggaatccgagttcgggaa
cggtttcctagtttgtttgaagatgattaccaccctgatgtctatacaataagagctacg
cagattcctcgggcatctgcaagtgctgtagcatttggaatggggttattcagtgagaaa
gggaatctgggaccaggccgtaatagagcattcgctgtcacaagtgaaaaccgtgctagt
gatacaaaactgagattttttgaatgttgtcaaaactacaagagctatagaaaagctaag
gaacctgctgtagataagctcaaggaacctgttttgaataagattacagcttccgttgca
aagagatatggtctaaatttcacaaaacaggatgtttcttctctctggtttctttgcaag
caggaagcatcattgcttaatgtaactaatcaaagttgtgaacttttcacgccatcagag
gttgctttgctggaatggacagatgacttggaagtgtttatcctcaaaggttatggcaat
tccttgaactacaaaatgggagttccattgctagaagatgttttgcattcaatggaagaa
gctatcaaggcccgggaagaaaagctcccacctggaagttacgaaaaagcaaggcttagg
tttgcacatgccgaaacaatagttcccttctcttgtcttcttgggcttttccttcatgga
tctgaatttgagaaaatacaaaaggaacaaccattggaactccctccacaacctcctaaa
accagagattttagaggcagcaccatggctccttttggtgggaacaacattcttgtcctc
tacagttgtccagcagattcctctcccaaatactttgttcaggttctgcacaacgagcat
cctatagcacttccaggttgtgacggaaaagatttctgttctcttgaagatttcaaggca
aaagtgctaacccctcatctaaagcatgcttttgacaacctctgcaatgctaatctagat
gacccaaaacagaagcctgcaccaagtaagttatctatactgttgagttggctgtatggg
tcgggccaggataccgagctctag

DBGET integrated database retrieval system