KEGG   Capsella rubella: 17897474Help
Entry
17897474          CDS       T02984                                 

Definition
(RefSeq) terpenoid synthase 29
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
crb  Capsella rubella
Pathway
crb00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    17897474
Enzymes [BR:crb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     17897474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth DMAP1_like FAM193_C
Motif
Other DBs
NCBI-GeneID: 17897474
NCBI-ProteinID: XP_006304904
UniProt: R0GPD0
Position
Unknown
AA seq 606 aa AA seqDB search
MEATRMGFGLRAYSHLRKSPHCPKTKLSLFPRRLLHIHTLSWKPTNLDLFVVRSHDLEGS
RPSTHFSPSLWGDHFLSVSLDRAEFDEQEREIEAMKPLVRDMLMSSHGSDKEKIRLIHLL
ISLGISYHFDKEIQEILKQSFTKLDDLIVGEDDLETISIMFEVFRLYGHKMSCDALYRFR
GEDGRFKESLARDVRGLLQLFEVAHLGTFSEDIMDEAMSFTRNHLESWVYGNVSSETTHL
SKHIQNSLYIPRYCNIEVLVAREYISYYEQEQGHDEILLKFAKLSFNFCQFLYIQELKTL
TKWWKDLDLASKLPYIRDRLVECHFGALGAYFEPQYSLARIIMAKIIMIVVVVDDTYDAY
ATLPEVTALTKCLQRWSIDVSDTLPDYLRIVLGSLFEVMEDIELEMKPKGRSYGVTQAIE
KLKILVKAYLEIAKWARTGHVSTFDEYMKVGYVSGAMGDFASYSFIGMEDINEKQSYDWL
NSNPLIIKKLSLMFRLSNDVGSYETEISRGEVANGLNCYMKQYGVTKDKASQELRKMYRD
HKKVVIEEFMNLHDDHVHVPRQVLLRCLNFARIFDVFYTEGDGFSEPKSKTQHFMTSLYV
HPIPIS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaacaagaatgggttttggacttagagcttattctcaccttcgaaaatcccct
cactgtcctaagaccaagctctcactattccctcgccgtttgcttcacatccacactttg
tcttggaagcccacaaatctcgacttgttcgttgtaaggtctcatgatcttgaaggtagt
cgtccttcaacgcacttttctccttccctttggggagatcactttctctctgtttccctc
gaccgcgctgaatttgatgaacaagaaagagagattgaagctatgaagccactggtgaga
gacatgcttatgtcttctcacggcagcgacaaggagaagattcgtctcatccatttgctc
atcagcctcgggatctcttaccattttgataaggagattcaagagatccttaaacagagt
ttcacaaagttggatgacctaatagtcggggaagatgatttggaaacaatctccatcatg
tttgaggtctttagactgtacggtcacaagatgtcctgtgatgccttgtatagatttaga
ggtgaagatgggaggttcaaggagagtctagccagagatgttagaggactgctacagttg
ttcgaagtagcgcatcttggaacattctctgaagatataatggatgaagcaatgagtttt
actaggaatcacttggagtcttgggtatatggcaacgtatctagtgaaactactcatctc
tctaagcatatacaaaactcattatacatacctcgatactgtaacatagaagtattagtg
gcaagagaatatatatcttactacgaacaagaacaaggtcacgacgagatcctgctcaag
tttgcaaagcttagcttcaatttttgccagtttctttacattcaagaactcaaaactctc
accaaatggtggaaggacttagatcttgcatctaagctaccttacattagggataggcta
gtagagtgtcatttcggggctctgggagcgtatttcgagccgcagtattcgcttgcgaga
atcatcatggctaaaatcatcatgatcgttgttgttgttgatgatacatatgatgcatat
gcaacccttcccgaagttacagctcttacaaaatgtttgcagaggtggagtattgatgtc
agtgatacattaccagactatttacgaatcgttctcggaagtttgtttgaagtcatggaa
gatattgaactagagatgaaaccaaaaggaagatcgtacggcgtgacacaagcaatagag
aagctcaagatccttgtgaaggcatacctcgagatagcaaagtgggcacggacgggtcat
gtatcaaccttcgatgagtacatgaaagttgggtatgtgtcaggtgcaatgggtgatttt
gcatcgtacagctttattggtatggaagacataaatgagaagcaatcttacgactggctc
aattccaatcccctaatcatcaaaaaactgtctttaatgttccgtctatcaaatgacgta
ggatcctacgagaccgagataagcagaggagaggttgctaatggactcaactgttacatg
aaacaatatggagtcaccaaggacaaagcatcccaagagttgcgtaaaatgtacagagac
cacaaaaaagtggttattgaggagttcatgaacttacatgatgaccatgtccatgtgcct
cgccaggttctgcttcgatgcctcaactttgcacgtatcttcgatgttttctacacagag
ggtgacggatttagtgaacccaaaagcaaaacccaacactttatgacctccttgtacgtt
cacccaatacccatttcataa

DBGET integrated database retrieval system