KEGG   Candidatus Carsonella ruddii CS (Ctenarytaina spatulata): A33Y_057Help
Entry
A33Y_057          CDS       T02195                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
crc  Candidatus Carsonella ruddii CS (Ctenarytaina spatulata)
Pathway
crc00340  Histidine metabolism
crc01100  Metabolic pathways
crc01110  Biosynthesis of secondary metabolites
crc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    A33Y_057 (hisD)
Enzymes [BR:crc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     A33Y_057 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFP83716
UniProt: J7GWA6
Position
44406..45638
Genome map
AA seq 410 aa AA seqDB search
MLNFVNNYFILKKNKKKKDFVLNIINDIKIYGEYALLYYIKKIDGIIIKNINNIKIYKKY
MKKAFIKLNFNKKKIIKEIFIRIKKYHFHFYKNSWQIINKNIIYGQKISKIEKICIYIPG
GNTIYPSSIFMNAVPSLIHKPKKLIMITPIKNGIISNLILSISYICNINYILLSGGVHTI
TSVTFGTKNIKKTNKITGPGNKFVTKSKKYLFGNIGIDMLAGPSELFILCEDNLHPKIII
NDFFSQLEHDINSISFLLSNNKKYLINIYNNIYKKIKYQKNKKIIFKSLNNSYIIFNNFY
NSLKIINFISPEHLMLCVKFSFKLLKKINNCGTIFLNYKTSISYGDYIIGPSHVIPTNKN
SKFCSSLNIDDFCKKINIIKTNNNLYSKILSSYFSKKEKFYSHSFSSILR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgttaaattttgtaaataattattttattttaaaaaaaaacaaaaaaaaaaaagatttt
gttttaaatattataaatgatataaaaatatacggagaatatgcattattatattatatt
aaaaaaatagatggaataattattaaaaatataaataatattaaaatatacaaaaaatat
atgaaaaaagcttttataaaattaaattttaataaaaaaaaaattattaaagaaattttt
ataagaataaaaaaatatcattttcatttttataaaaattcatggcaaattattaataaa
aatattatttatggtcaaaaaatatcaaaaattgaaaagatatgtatttatattccaggt
ggaaacaccatttacccttcttctatttttatgaacgctgttccttctttaattcataaa
cctaaaaaattaataatgataacacctattaaaaatggaataatttcaaatttaatttta
tctatatcttatatttgtaatataaattatattttattatctggaggtgttcatacaata
acaagcgtaacttttggaactaaaaatattaaaaaaactaataaaattacaggtccagga
aataaatttgttactaaatcaaaaaaatatttatttggtaatattggtattgatatgcta
gctggcccttcagaattatttattttatgtgaagataatctacatccaaaaattattata
aatgattttttttcacaactagaacatgacataaattcaatttcttttttattatctaat
aataaaaaatacttaattaatatttataataatatatataaaaaaataaagtatcaaaaa
aataaaaaaataatatttaaatcattaaataatagttatattattttcaataatttttat
aattcattaaaaataataaattttatttcaccagaacatttaatgttatgtgtgaaattt
tcttttaaattattaaaaaaaattaataattgtggtacaatttttttaaattataaaact
agtatttcttacggtgattatataattggaccaagtcacgttataccaactaataaaaat
tctaaattttgttcttctttaaacatagacgatttttgtaaaaaaattaatataataaaa
acaaacaataatttatattctaaaatattatcttcttatttttctaaaaaagaaaaattt
tattctcatagtttttcttcaattttaagatga

DBGET integrated database retrieval system