KEGG   Corynebacterium resistens: CRES_0183Help
Entry
CRES_0183         CDS       T01538                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
crd  Corynebacterium resistens
Pathway
crd00790  Folate biosynthesis
crd01100  Metabolic pathways
Module
crd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CRES_0183 (folE)
Enzymes [BR:crd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CRES_0183 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI CbiG_N
Motif
Other DBs
NCBI-ProteinID: AEI08546
UniProt: F8E1Z2
Position
223416..223946
Genome map
AA seq 176 aa AA seqDB search
MLFAVGENPDREGLKDTPARVARAYEEIFAGLYTDPTEVLDKTFNEDHRELVLVRDIPFY
STCEHHLVPFFGHAHIGYIPGTSGKVTGLSKLARLIDGLAKRPQVQERLTSQVADALVER
LEASAVIVVIEAEHLCMAMRGIRKPGANTVTSAVRGGFRTNASSRAEAMALIQRGR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
ctgcttttcgcagttggagaaaacccggatcgggaggggctgaaggacactccagcccgt
gttgcccgcgcctatgaagaaatctttgccgggttgtacaccgacccaaccgaagtgctg
gataagacctttaacgaggatcaccgcgagctcgttctcgttcgcgacatcccgttttat
tcgacgtgtgaacaccacctcgtgccttttttcgggcacgctcacattggctatatcccg
ggcacctcgggcaaagttaccggcctttccaagctcgcgcgcctcatcgatggccttgcc
aagcgcccccaagtgcaagaacggctgacgtcccaagtcgcggatgctttggtggaacgc
ctcgaagcctccgcagtcatcgtcgtcattgaagctgaacatctttgcatggccatgcgc
ggcatccgcaaacccggtgcgaacacggtcacttctgcggttcgaggcggtttccgcacg
aatgccagttcccgcgcagaagccatggctttgattcaacgaggccgctaa

DBGET integrated database retrieval system