KEGG   Corynebacterium resistens: CRES_0202Help
Entry
CRES_0202         CDS       T01538                                 

Gene name
pitB1
Definition
(GenBank) putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
crd  Corynebacterium resistens
Brite
KEGG Orthology (KO) [BR:crd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CRES_0202 (pitB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEI08565
UniProt: F8E211
Position
242704..244356
Genome map
AA seq 550 aa AA seqDB search
MANQRPSGGPANTRPVETLQLSEDTVQPQLGSDKWWHIAFGGMLLVAVIYFGVWTSQHVP
SSANYFVLAITVIFGLFMAFNIGGNDVANSFGTSVGAGTLTMKQALIVAAVFEVGGALLA
GGSVTKTVRSGIVDLNKIDLMPMDFVYIMIAALMGAAIWLLVATKKGWPVSTTHSIVGGI
VGAALCLGFTTHTGGWAMVQWAEIGRIASSWVISPLLGGLAAYLLFSVIKRTVLQYNDRA
NAGMERIRRARLNHATRHKDLFRGLSEVQQIAYNNEMARDAVTYTRADFTREDLESDYYR
ELYDLDQEAKRLNVHKALIYGAPPLAAFGAVVITAMLLFKGLSNLDVHVSTVGSLLIMAM
IAVLVWSSVYMVAKALRKETVDRSTFILFSWMQVFTASAFAFSHGSNDIANAVGPFAAIV
DVLSTNQINSEAAVPTALLLACGIALVAGLWFIGRNVITTVGSGLTNIHPASGFAAELAA
AAVVMTASLLGLPVSSTHILIGAVLGVGIVNHEANWGLMKPIALAWVITIPVAAGIGAAG
LFVLRAMFGV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccagcgccccagtgggggtccagcaaacactcggccagtggaaacactccaa
ctttctgaagatactgtgcagccccagttgggtagtgacaagtggtggcacattgccttt
ggcggaatgctgttggtggcggtcatttactttggtgtttggacttcgcaacacgtaccg
tcttcggccaactactttgttctcgcgatcaccgtcatttttggtcttttcatggccttc
aatatcggcggcaacgatgtggcgaactccttcggcacgtcagtgggtgctggaacgctt
acgatgaagcaggcgctcatcgtcgcagccgtatttgaagttggcggtgcgctgctcgcc
ggtggctcggtcactaagactgtgcgcagtggcattgtcgatctcaacaagatcgatctg
atgccgatggactttgtctacatcatgatcgctgccctcatgggtgccgcgatctggttg
cttgtcgccactaagaagggctggcccgtctctaccacccactcaattgtgggtggcatc
gttggcgccgctctgtgcttgggctttaccactcacaccgggggatgggcgatggtgcag
tgggccgaaattggtcgaatcgcatcatcctgggtcatctctccactcctaggcggcctg
gcggcgtacctgctgttcagcgtaatcaagcgaactgtattgcagtacaatgaccgcgca
aacgccggcatggagcgcattcggcgtgcgcgactgaatcacgctacgcgacacaaggat
ttgttccgtggccttagcgaggtacagcagattgcctataacaacgaaatggcccgcgat
gccgtgacttacacgcgcgcagacttcacccgcgaggatttggaaagcgactactaccgc
gagctctatgacctcgatcaggaggcgaagcgcctaaatgtgcacaaagctttgatttat
ggggctccgccattggcggcgttcggcgcagtggttattactgccatgctgcttttcaaa
ggcttgtccaatctagacgtgcacgtttccactgtgggttcactgctcatcatggcgatg
attgctgtcttggtgtggtccagtgtctatatggtcgccaaggctttacgcaaggagaca
gtcgaccggtccactttcatcttgttcagttggatgcaggttttcactgcttctgccttt
gcgtttagccacggttccaatgacatcgccaatgcagtcggccctttcgccgcgattgtg
gatgtattgtccaccaaccagatcaactcggaagcagctgtgccaaccgctttgctgttg
gcctgcggtattgctttggtggcggggctttggttcatcggtcgaaacgtcatcacgacc
gtgggttcaggcttgacgaacatccacccggccagtggatttgccgctgaactcgctgcc
gctgcggtggtgatgaccgcgtcacttctggggctgccagtatcctccacccatattctc
attggtgctgttctgggcgtgggcattgtgaatcacgaagccaactggggattgatgaag
cccatcgcgctggcatgggtgatcaccatcccagtggcagccggaatcggcgctgccggt
ctgttcgttcttcgcgctatgtttggggtctag

DBGET integrated database retrieval system