KEGG   Corynebacterium resistens: CRES_0770Help
Entry
CRES_0770         CDS       T01538                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
crd  Corynebacterium resistens
Pathway
crd00010  Glycolysis / Gluconeogenesis
crd00052  Galactose metabolism
crd00500  Starch and sucrose metabolism
crd00520  Amino sugar and nucleotide sugar metabolism
crd00521  Streptomycin biosynthesis
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01120  Microbial metabolism in diverse environments
crd01130  Biosynthesis of antibiotics
crd01200  Carbon metabolism
Module
crd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CRES_0770 (glk)
   00052 Galactose metabolism
    CRES_0770 (glk)
   00500 Starch and sucrose metabolism
    CRES_0770 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CRES_0770 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CRES_0770 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CRES_0770 (glk)
Enzymes [BR:crd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CRES_0770 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DEDD_Tnp_IS110 Hydant_A_N DGOK TCR
Motif
Other DBs
NCBI-ProteinID: AEI09126
UniProt: F8DZY7
Position
952682..953704
Genome map
AA seq 340 aa AA seqDB search
MGRKRETGKGNTSVTEDFLTIGVDIGGTNFRAAVVDESGTILAVEQLPTPSNVEALEKAL
EQVITQLCEQHSTAKRPIVAVGLAIAGFIDETRTHVRFAPHLPWRNTELVQRLRRRLELP
VVIEHDANSAAWGEYFQGAAQGEDTWVLFALGTGIGAAVMHKGEIYRGAFGTAPEFGHLT
VMPGGRACPCGKMGCLERYCSGSALPLTAQDFIATGCCPESALTKTYANHPEEITGRAVV
RLAREGDGLALDVVDDMATWLGRGLALVQDVFDPSLIVLGGGVSQDADLFLPAAREVMAN
NIVGAGHRRVARVVQGQLGGDAGMIGVALLARREADPQKQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggacgaaagcgcgaaaccggaaagggcaacacgagcgtgacggaagactttctcaca
attggtgtggatatcggaggaaccaacttccgggccgccgtggtcgatgaaagcggcact
attttagccgtggaacagttgcccacaccctccaacgtcgaagccttggagaaagcgctc
gaacaagtgatcacccagctatgcgaacagcattccacggccaagcgtccgatcgttgcc
gtggggttagctatcgccgggttcattgacgaaacacgcacgcacgtccggttcgcacca
catttgccatggcgcaatacggaactcgtgcagcgcctccgccgccggctggagttgccg
gtagttatcgagcatgacgccaactcggccgcttggggtgaatacttccaaggagccgct
caaggtgaagacacttgggtgctctttgccctggggacaggcattggcgctgcggtaatg
cataaaggcgaaatttatcgtggggccttcgggacagccccagagtttggccatctaacg
gtgatgcccggtggtcgagcatgcccctgcgggaagatgggctgtctcgaacgctactgt
tccggttctgcccttccgctcaccgcacaggatttcatcgcaactggatgttgccctgaa
tccgcgttgactaaaacttacgcgaatcatccagaggaaataaccggccgagcagttgta
cgcctcgcgcgtgagggtgacggtctggccctcgatgtcgttgacgatatggcaacgtgg
ctcggtagggggctcgcgctggtacaggacgtgtttgacccatccctcatcgttcttggc
ggtggtgtttcacaagatgcggaccttttcttaccagcagcccgtgaggtcatggccaac
aacatcgtaggggccgggcaccgtcgcgttgcgcgcgtggtgcagggtcaactgggaggc
gatgccggtatgatcggcgtagcactattggcgaggcgcgaagctgacccgcaaaagcaa
taa

DBGET integrated database retrieval system