KEGG   Corynebacterium resistens: CRES_0919Help
Entry
CRES_0919         CDS       T01538                                 

Gene name
fadA2
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
crd  Corynebacterium resistens
Pathway
crd00071  Fatty acid degradation
crd00072  Synthesis and degradation of ketone bodies
crd00280  Valine, leucine and isoleucine degradation
crd00310  Lysine degradation
crd00362  Benzoate degradation
crd00380  Tryptophan metabolism
crd00620  Pyruvate metabolism
crd00630  Glyoxylate and dicarboxylate metabolism
crd00640  Propanoate metabolism
crd00650  Butanoate metabolism
crd00900  Terpenoid backbone biosynthesis
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01120  Microbial metabolism in diverse environments
crd01130  Biosynthesis of antibiotics
crd01200  Carbon metabolism
crd01212  Fatty acid metabolism
crd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:crd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CRES_0919 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    CRES_0919 (fadA2)
   00640 Propanoate metabolism
    CRES_0919 (fadA2)
   00650 Butanoate metabolism
    CRES_0919 (fadA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CRES_0919 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    CRES_0919 (fadA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CRES_0919 (fadA2)
   00310 Lysine degradation
    CRES_0919 (fadA2)
   00380 Tryptophan metabolism
    CRES_0919 (fadA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CRES_0919 (fadA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CRES_0919 (fadA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CRES_0919 (fadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:crd04147]
    CRES_0919 (fadA2)
Enzymes [BR:crd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CRES_0919 (fadA2)
Exosome [BR:crd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CRES_0919 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEI09275
UniProt: F8E1B1
Position
1123418..1124734
Genome map
AA seq 438 aa AA seqDB search
MTAGTPRKVAILGGNRIPFARSNKEYANASNQDMLTAAIDGLVARYGLQNEELGLVVAGA
VLKHSRDFNLTRETVLGSALASSTPAFDLQLACGTGLAALVQVADAIALGRIESGIAGGV
DTTSDAPLAVNDSLRKTLIKLNNAKTAGDRLKLVGSIRPGQLAPEQPSNGEPRTGLSMGD
HAAITAREFNLTREEQDQLAMESHQKLAKAYEEGFFEDLITPFLGVQRDTNLRPDSNMEK
LGKLKPVFGKRDAVEHGTKATMTAGNSTPLTDGASAVLVASEEWAQQHNIPVRAYLVDSE
VASVDFLQGHDGKTPDGLLMSPTYAVPRLLERNGLTLQDFDFYEIHEAFASQTVATLKAW
ESEEYCRERLGLDKPLGSIDREKLNVKGSSLAAGHPFAATGGRIIATAAKLLEEKGSGRA
LISICAAGGQGVVAILER
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaggtaccccacgcaaggtcgccattctcggtggcaaccgcattccctttgcc
cgttccaacaaggaatacgccaacgcatccaaccaggacatgctgactgccgctatcgac
ggcctcgtagcgcgctacggattgcagaacgaagaactcggtttggtggttgccggtgcg
gtgctgaagcattcccgcgatttcaacctgacccgcgaaaccgttttggggtccgctcta
gctagctccaccccggcattcgatctgcagcttgcttgtggtaccggcttggcagctctg
gttcaggtagccgacgccatcgcgctgggtcgcatcgagtccggcatcgccggcggtgtg
gatactacttccgacgccccgctggcagtcaacgacagcctccgcaagaccctcattaag
ctgaacaacgctaagaccgccggtgatcgcctgaagctcgttggttctatccgcccaggc
cagctggcacccgagcagccctctaatggcgagccgcgcactgggctgtccatgggtgat
cacgctgccatcaccgcccgcgagttcaacctgacccgcgaggagcaggaccagttggca
atggaatctcaccagaagctggccaaggcttacgaggaaggtttcttcgaggacctcatc
actccgttcttgggtgttcagcgtgataccaacctgcgccctgattccaacatggaaaag
ctgggtaagttgaagccagtcttcggcaagcgcgatgctgtggagcacggaacaaaggcc
actatgaccgctggtaactccactccgctgaccgatggtgcttctgcagtgctggttgct
tccgaggaatgggctcagcagcacaacattccagtgcgtgcttacctggttgattctgag
gttgcgtccgtggactttttgcagggccacgatggtaagactccagacggtctgctgatg
tccccaacttatgcagtcccgcgcttgctcgagcgtaacggcctgaccttgcaggacttc
gatttctacgaaatccacgaggcattcgcatctcagaccgttgccaccctcaaggcatgg
gaatccgaggagtactgccgcgagcgcctcggactggacaagccactggggtccatcgac
cgcgagaagctcaatgttaagggttcctccttggctgcgggtcacccattcgctgcaacc
ggtggtcgcatcattgctaccgcagcgaagctgcttgaggaaaagggcagtggccgtgcg
ctgatctccatctgtgctgcaggtggacaaggtgtagttgctatcttggagcgctaa

DBGET integrated database retrieval system