KEGG   Corynebacterium resistens: CRES_0979Help
Entry
CRES_0979         CDS       T01538                                 

Gene name
fhs
Definition
(GenBank) Formyltetrahydrofolate synthetase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
crd  Corynebacterium resistens
Pathway
crd00670  One carbon pool by folate
crd01100  Metabolic pathways
crd01120  Microbial metabolism in diverse environments
crd01200  Carbon metabolism
Module
crd_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:crd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CRES_0979 (fhs)
Enzymes [BR:crd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CRES_0979 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AEI09335
UniProt: F8E1R8
Position
complement(1200113..1201852)
Genome map
AA seq 579 aa AA seqDB search
MKVMTTAAQPTDVEIAQAHELQPIEDIATKANIPSEALLPFGRAKAKIDIGALNSKMPQE
SLQSPNTAAKTPNGQLVLVTAMSPTPAGEGKSTVLIGLADAMNLRGHNSIVAIREPSQGP
VMGIKGGAAGGGYAQVVPMEDINLHFTGDMHAITAATNTLAAIVDNHIHHGNALNIDPRR
VTWRRCLDVNDRALRNIVTGLGGPVQGVPREAGFDITAASEIMAILCLASDFADLKTRLG
RIVVGQTYDRSPVTAADLKATGALAVLLRDAINPNLVQTLGGTPALVHGGPFANIAHGCN
SLVATKTALGLADVVLTEAGFGSDLGAEKFFDIKARAGDLNVGAVVIVATIRSLKFNGGV
AKSDLTSENLEALEAGLVNLERHVANTRKFNTEPVVALNAFASDTPAEREALQAWGEKHG
VRVVETRVWAEGGDGALDLADTVARVLEQDKQKRSPSLPLYDPAEGIESSLHTIATEIYG
AKGVELSNAARKDLQFLKDNGWDTLPVCISKTQYSFTDDASALGAPTGHILHVRQLVPRI
GAGFIVALTGDVMTLPGLPKHPAAEGIDLDGSGKIMGLF
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttatgactacagcagcacagcccactgatgttgaaatcgcccaagcgcatgag
ttgcagcccattgaggatattgccaccaaggcgaacatcccttcagaagctttgcttcca
tttggtcgggcgaaggccaagatcgatatcggggcattgaactcgaagatgccgcaagag
tcgctgcagtcacctaacacagcagccaagaccccaaacgggcagttagtgttggtcaca
gccatgagccccacccccgctggtgagggtaaatcgacagtgctgatcggtttggccgat
gcgatgaatcttcgggggcacaactccattgtggccattcgcgaaccttcacaagggcca
gtcatgggcatcaagggaggcgctgccggcggcggatacgcgcaggttgttcccatggag
gacatcaatctgcacttcactggcgatatgcatgcaatcacggcagctacgaacactttg
gccgccatcgtcgataatcacattcaccacggcaatgctcttaacattgatccgcgccga
gtcacgtggcgccgttgcctcgatgtcaacgaccgtgcgctgcgcaatatcgtgactggc
cttggcggcccagtacagggcgtaccccgagaagccggattcgatatcaccgctgctagc
gagatcatggctatcctctgtttggctagcgatttcgcagacctcaagactcgtctcggc
cgaattgtggtgggccagacctacgatcgctctcctgtcactgccgccgatctcaaggcc
acgggcgcgcttgcggtgttgcttcgcgacgccatcaatcccaacttggtacaaaccttg
ggtggcacacccgctttggttcacggggggccttttgcgaatatcgctcacggatgtaat
tcccttgtcgcgacaaaaacggctttaggcttggcggatgtagttctgaccgaagctgga
ttcggttcagatttgggtgcggaaaaattctttgacatcaaggctcgtgccggcgatttg
aacgtcggtgctgtcgtcatcgtagctaccattcggtctttgaagttcaatggtggtgtg
gcaaagagtgacctcaccagcgaaaacctcgaagccttggaggccgggttggtgaacctg
gaacgccatgtggcgaacacgcgcaaattcaataccgaaccggtggtcgctttgaatgct
ttcgcttccgacaccccagcagagcgggaagcgttgcaggcatggggtgaaaagcatggc
gtgcgcgtggttgaaacgcgcgtctgggcggaaggtggcgatggagccttggacctggcc
gatacggtggcccgtgtgctcgagcaggacaagcagaagcgttccccttccctgccactc
tacgatcccgctgaggggatcgagtccagcttgcacaccatcgctaccgagatttacggc
gccaaaggtgttgagctttcgaatgcagcccgcaaggatctccagttcctgaaagacaac
ggttgggacactcttccggtgtgtatttccaaaacccagtacagtttcaccgatgatgcc
tcggcactgggcgctcctaccgggcatatcttgcatgttcgtcagctggtaccccgtatt
ggcgcgggcttcatcgtcgcactgaccggtgacgtcatgactctgcctggacttccgaaa
catcccgctgcggaggggatcgatttggacggatccgggaagattatgggcttgttctga

DBGET integrated database retrieval system