KEGG   Corynebacterium resistens: CRES_1100Help
Entry
CRES_1100         CDS       T01538                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
crd  Corynebacterium resistens
Pathway
crd00230  Purine metabolism
crd01100  Metabolic pathways
Module
crd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CRES_1100 (gmk)
Enzymes [BR:crd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CRES_1100 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin
Motif
Other DBs
NCBI-ProteinID: AEI09456
UniProt: F8E2Z6
Position
complement(1341887..1342384)
Genome map
AA seq 165 aa AA seqDB search
MARLIEEIPGLFFSVSMTTRDPRPGEVDGKDYLYVTREQFQDHIDSGKMLEWAEIHGGLQ
LSGTPREPVEAALDEGRPVLVEVDLEGARNVKKLLPEARTIFLAPPSWEILVERLTNRGT
ETEDVIARRLHTAKTEMAAQSEFDHVVVNENVDKAVAEIGEILNR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcggctcatcgaggagatccctggcctgttcttcagcgtttccatgaccacccgg
gatccccgtcccggcgaggtggacggcaaagactacctctacgtcactcgtgagcagttt
caggatcacatcgattccggaaagatgctggagtgggccgaaattcacggtgggctgcag
ctttccggtactccacgagagcccgtagaagctgcgctcgacgaaggtcggccggttctc
gttgaagtggacctagaaggtgctcgcaacgtcaagaagttgctccccgaagcgcgtacg
atcttccttgcgccaccttcgtgggaaatcttggttgagcggttaaccaatcgaggaacc
gaaaccgaggacgtgattgcgcggcggctgcacaccgccaaaacggaaatggcagcgcaa
tcggagtttgatcacgtagtggtcaatgagaatgtggataaggcagtcgctgaaattggc
gagattctcaaccgctaa

DBGET integrated database retrieval system