KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_100162Help
Entry
CHLREDRAFT_100162 CDS       T01039                                 

Gene name
HTB18
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
cre  Chlamydomonas reinhardtii
Brite
Chromosome and associated proteins [BR:cre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CHLREDRAFT_100162 (HTB18)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CHLREDRAFT_100162 (HTB18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa 4HB_MCP_1 DUF3915 NPR3
Motif
Other DBs
NCBI-GeneID: 5716479
NCBI-ProteinID: XP_001691007
JGI: 100162
UniProt: A8IJS4
Position
Unknown
AA seq 153 aa AA seqDB search
MAPKKDEKPATQEAAAEAPAKAEAKPKAEKAAKKAKKEPSKKAAKEPKGDGEKKDKKKKK
SAVETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATEASKLSRYNKKPTVTS
REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaggacgagaagcccgcgactcaggaggctgccgctgaggcccctgcc
aaggccgaggccaagcccaaggccgagaaggccgccaagaaggccaagaaggagccctcc
aagaaggctgccaaggagcccaagggcgatggcgagaagaaggacaagaagaagaagaag
agcgccgtggagacctacaagctgtacatctacaaggtgctcaagcaggtgcaccccgac
actggcatcagcagcaaggccatgtccatcatgaacagcttcatcaacgacatctttgag
aaggtggccaccgaggcctccaagctgagccgctacaacaagaagcccaccgtgacctcc
cgcgagatccagaccgctgtgcgcctggtgctgcccggcgagctggccaagcacgcggtg
tcggagggcaccaaggccgtgaccaagttcacctcgggctaa

DBGET integrated database retrieval system