KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_102205Help
Entry
CHLREDRAFT_102205 CDS       T01039                                 

Gene name
HTB38
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
cre  Chlamydomonas reinhardtii
Brite
Chromosome and associated proteins [BR:cre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CHLREDRAFT_102205 (HTB38)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CHLREDRAFT_102205 (HTB38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like 4HB_MCP_1 NPR3
Motif
Other DBs
NCBI-GeneID: 5718645
NCBI-ProteinID: XP_001692948
JGI: 102205
UniProt: A8IW84
Position
Unknown
AA seq 155 aa AA seqDB search
MAPKKDEKKDAAAPEAAEPKAEKESKPKADKAAKKAKKSPAKKAAKEGGDGEKGDKKKGK
KKSSVETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATEASKLSRYNKKPTV
TSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcccctaagaaggacgagaagaaggacgcggccgctcccgaggctgctgagccgaag
gcggagaaggagtccaagcccaaggcggacaaggccgccaagaaggccaagaagtcgccc
gctaagaaggctgccaaggagggcggcgacggcgagaagggcgacaagaagaagggcaag
aagaaatcgtcggtcgagacctacaagctctacatctacaaggtgctcaagcaggtgcac
cccgacaccggcatcagcagcaaggccatgtcgattatgaacagcttcatcaacgacata
ttcgagaaggtggccaccgaggcctccaagctcagccgctacaacaagaagcccacggtc
acctcccgcgagatccagaccgcggtgcgcctggtgctgcccggcgagctggccaagcac
gcggtgtcggagggcaccaaggccgtgaccaagttcacctcgggctaa

DBGET integrated database retrieval system