KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_108443Help
Entry
CHLREDRAFT_108443 CDS       T01039                                 

Definition
(RefSeq) predicted protein
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran DUF87 MMR_HSR1 AAA_29 AAA_16 AAA_21 AAA_22 AAA_10 SMC_N
Motif
Other DBs
NCBI-GeneID: 5728437
NCBI-ProteinID: XP_001702874
JGI: 108443
UniProt: A8JGZ4
Position
Unknown
AA seq 71 aa AA seqDB search
GLPPVLRGITFSLPPGSSCGVVGRTGSGKSSLMLTLFRLIPVTAGRILLDGQDTAGLGLD
VLRRQLAIIPQ
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
ggcctgccgcccgtgctccgcggcatcaccttctccctgccgcccggcagcagctgcggc
gttgtgggccgcaccggcagcggcaagagcagcctgatgctgacgctgttccggctcatc
ccggtcacggcgggccgcatcctgctggacgggcaggacacggcggggctggggctggac
gtgctgaggcgccagctggccatcataccgcag

DBGET integrated database retrieval system