KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_142791Help
Entry
CHLREDRAFT_142791 CDS       T01039                                 

Gene name
CYG15
Definition
(RefSeq) guanylate cyclase
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00230  Purine metabolism
cre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CHLREDRAFT_142791 (CYG15)
Enzymes [BR:cre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     CHLREDRAFT_142791 (CYG15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB Hep_core_N
Motif
Other DBs
NCBI-GeneID: 5726586
NCBI-ProteinID: XP_001701038
JGI: 142791
UniProt: A8I733
Position
Unknown
AA seq 619 aa AA seqDB search
MISARWINISVESFVREKFGDAVWEQTLSTSGVQAGWVSSCPYPDAATYGLVITASSILG
VTPAQALEAYGVYFVEYTARLGYEKLLKSLGSNMAEFLKNLNDLHLHLGMSFPAMAAPAF
KCTDVGPTCLTLHYHSHRPALGPIVVGVLKGLAEQYWGLGGDQLQVELLRGRDDGSDDHE
VFRVSYPHQAALQHCGPPAASVDGSQAAGSAASTASPAAAAARSFTLNPNDFYQLFPFHL
LLDRSCRVVQAGAMLERLLPELRGQSGVPLGDVFQLKHPHRPLDFETVTRELDNIFVLKA
HVSGLELKGQMVAVPLPLHPGAGCPATQEGLLFMGTARLAGLDDMRHHGIFISDIPHHDI
NRDYVLLAEQRQAEAQLQERLEYLTRELKDTNSRLDEERRRSDRLLYQMLPPEVASCLKN
EERAPAQEHPEATVLFSDIVGFTEIASRSSPLEVCSLLDELYQRFDGAIEEYPQLYKVET
IGDAYMVVCNVTVPCDDHADVLLEFALRMHEEASRVASSLGEPVRIRVGMHSGPVVAGVV
GRKMPRFCLFGDTVNTASRMESHGEAGQIHISEACYSCLRSKERFEIRERGNITVKGKGT
MRAWQPIPQPAAGACVDLA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatatcagcgcggtggatcaacatctccgtggagagcttcgtccgggagaaatttggg
gatgccgtctgggagcaaaccctgtcgacctcaggcgtgcaggcgggctgggtgtcgtcg
tgcccctaccccgacgccgccacctacggcctcgtcattaccgcatccagcatcctgggg
gtgactcccgcacaagccctggaggcgtacggagtgtactttgtggagtacactgcccgc
ctggggtatgagaagctgctgaagagcttgggaagcaacatggccgagttcctcaagaac
ctgaacgacctgcacctgcatctcggcatgagctttcccgccatggcggcgcccgccttc
aagtgcacggacgtggggcccacttgcctgacgctgcattaccacagccaccggccggcg
ctgggccccattgtggtgggtgtgctcaagggcctcgcggagcagtactggggcctgggc
ggcgatcagctgcaggtggagctgctgcgggggcgagacgacggcagcgatgaccacgag
gtgtttcgggtcagctaccctcaccaagcagcgcttcagcactgcgggccgcctgcggcc
agcgttgatggcagccaagccgccggctctgctgcctccaccgcctccccagcagcggcg
gctgcgcgtagctttacgctgaacccgaacgacttctaccagctcttccccttccacttg
ctgctagaccgcagctgccgcgtagtgcaggcgggggcgatgctggagcggctgcttccg
gagctgcgcgggcagagcggcgtgccgctgggggacgtgttccagctgaaacacccgcat
cggccgctggacttcgagaccgtgacccgagagcttgacaacatctttgtcctaaaagcc
catgtgagcggtctggagctcaaaggtcagatggtggctgtgccgctgccgctgcacccg
ggcgctggctgccccgccacccaggagggcctgctcttcatgggcacggcacgcctagcg
ggcctcgacgacatgcgccaccacggcatcttcatctccgacatcccgcaccacgacatc
aaccgggactatgtgctgctagcggagcagcgccaggcggaggcgcagctgcaggagcgg
ctggagtacctcacgcgtgaactcaaggacaccaactcgcgcctggacgaggagcggcgg
cgcagtgacaggctgctttaccagatgctgcctcccgaggtggccagctgcctcaagaat
gaggagcgggcgccggcacaagagcacccagaggccacggtgctgtttagcgacatagta
ggcttcacggagattgcttcacgcagctcgccgctggaggtgtgctcgctgctggacgag
ctgtatcagcgcttcgacggggccattgaggagtacccgcagctgtacaaggtggagacc
atcggggacgcatacatggtggtgtgcaacgtgacggtgccgtgtgacgaccatgcggac
gtgttgctggagtttgcgctgcgcatgcacgaggaggccagtcgggttgccagcagcctg
ggggagcccgtgcgcatccgcgtgggcatgcactcgggcccggtggtggcgggcgtggtc
ggccgcaagatgcctcgcttctgcctgtttggcgacaccgtcaacacggccagccgcatg
gagtcccacggcgaggccggccagatccacatcagcgaggcctgctacagctgcctccgg
tccaaggagcgctttgagatccgggagcgaggcaacatcactgtcaagggcaagggaacc
atgcgggcctggcagcccatccctcagccggcggccggcgcgtgcgtcgacctggcatag

DBGET integrated database retrieval system