KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_165863Help
Entry
CHLREDRAFT_165863 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CHLREDRAFT_165863
Enzymes [BR:cre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CHLREDRAFT_165863
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CHLREDRAFT_165863
DNA repair and recombination proteins [BR:cre03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CHLREDRAFT_165863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco FbpA
Motif
Other DBs
NCBI-GeneID: 5728140
NCBI-ProteinID: XP_001702534
JGI: 165863
UniProt: A8IBT5
Position
Unknown
AA seq 297 aa AA seqDB search
MPELPEVEAARGLVELGCKGKTILVARVADDEKVINGCTPDELRKALEGRTLLRAHRKGM
TGGIVVKGVGVTKYKRAHLESDPESWPPRFTKLELELQGGGRLAYVDSRRFGRIKLLPGP
DPLACEPLCRLGWDVLLQLPPTAAQFGQVVRERVVRAPSLRIKALLLDQEFCSGIGNWVA
DEVLYQARIHPEQTATSLDDGSMAALHAAIREVVGLAVRVEADSDRFPRDWLFHYRRVCL
CLWTNKKASQDASGRAIHFVTVGSRTSAFVPAVQQLKGSGAAGRAKAAAAKEAEEGG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgccggaggtcgaggcagcccgcggcctagtggagctgggctgcaagggg
aaaacaatcttggtggccagggtcgcagacgacgagaaggtcatcaacggctgcacaccg
gatgagctgcgtaaagcgctggaagggcgcacgttgttacgcgcccaccggaaaggcatg
actgggggcatcgtggtcaagggagtgggcgtcactaagtacaagcgtgcccacctggaa
tcggacccggagtcctggccgccgcgcttcaccaagttagagttggagctgcagggcggc
ggcaggctggcctacgtggactcgcgccggttcggccgcatcaagctgctccccggcccc
gacccgctggcctgcgagccgctgtgccggctgggctgggacgtgctgctgcagctgccg
cccaccgccgcgcagttcggccaggtggtgcgggagcgggtggtgcgcgcgccctcgctg
cggatcaaggcgctgctgctggaccaggagttctgcagtggcatcggcaactgggtggcg
gacgaggtgttgtaccaggcgcgcatccacccggagcagacggccacgtccctggacgac
ggctctatggccgccctgcacgccgccatccgcgaggtggtgggcctggcggtgcgggtg
gaggcggactcagaccgcttccccagggactggctcttccactacaggcgcgtgtgcctg
tgcctgtggacgaacaagaaggccagccaggacgccagcgggcgcgcgattcacttcgta
accgtgggcagccgcacctcggcctttgtgccggcggtgcagcagctcaagggctcgggg
gcggccggccgggccaaggcagcggccgccaaggaagcggaggagggcgggtga

DBGET integrated database retrieval system