KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_166438Help
Entry
CHLREDRAFT_166438 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K20003  palmitoyltransferase ZDHHC4 [EC:2.3.1.225]
Organism
cre  Chlamydomonas reinhardtii
Brite
KEGG Orthology (KO) [BR:cre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cre04131]
    CHLREDRAFT_166438
Enzymes [BR:cre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     CHLREDRAFT_166438
Membrane trafficking [BR:cre04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    CHLREDRAFT_166438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC PSI
Motif
Other DBs
NCBI-GeneID: 5727465
NCBI-ProteinID: XP_001701967
JGI: 166438
UniProt: A8I946
Position
Unknown
AA seq 337 aa AA seqDB search
MDLFLFAIGYLGLTAFFIGILLFGESPVFRNTPIASLHWFVTQGIFDGLGWIVAKTCGAR
GARALDSVYLTCCERPNAALQVAYLAMVLGGYWLYWNNLFSLLPNPWADRDHILLGSASV
AVSLGLFVFASASDPGTIRAGDADTLAAWHALYPLDNAIWPEKTCSTCGLCVARHDHHCA
WINNCVGAANMRHFLAFLVANLAMCAYGAVLACVILGGEMEARGVWRLNLVNYATGRVVP
MWRVPSKMLEWLIVLYPVGVAVGLFMGVATLLVAFFLSYQLYLLAVGRTQYEMFRWRDLH
HQMLEEAEQQEEQRIAAEREAATREAEAAGKGGGGKQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggacttattcttatttgcaataggctatcttggcttgaccgcgttctttattggcatc
cttcttttcggcgagagtcctgtgtttcgcaacacccctatagcctcattgcactggttc
gtgacccagggcattttcgatggcctgggatggattgtggccaagacatgcggcgcgcgg
ggcgccagggcgcttgactcggtgtacttgacctgctgcgagcggcccaacgcggccctg
caggtggcgtacctcgccatggtcctgggcggctactggctctactggaacaacctgttc
tcgctgctgcccaacccgtgggcggacagggaccacatcctgctgggctcggcttccgtg
gcggtcagcctagggctgtttgtgtttgcctcggcgtcagacccgggtacaatccgcgcc
ggcgacgccgacacgttggcggcctggcacgcgctgtacccgctggacaacgccatctgg
cccgagaagacctgctccacctgcggcctgtgtgttgcccggcacgaccaccactgcgcc
tggatcaacaactgcgtgggggccgccaacatgcgccacttcctggccttcctggtcgcc
aacctggccatgtgcgcctacggggcggtgctggcgtgtgtgatcctgggcggcgagatg
gaggcacgtggcgtgtggcggctgaacctggtcaactacgccaccggcagggtggtgccc
atgtggcgcgtgcccagcaagatgctggagtggctcattgtgctgtacccggtgggggtg
gccgtggggcttttcatgggcgtggcaacgctgctggtcgcgttcttcctgtcgtaccag
ctgtacctgctggcggttggccgtacacagtacgagatgttccgttggcgcgacctgcac
caccagatgctcgaagaggcggagcagcaggaggagcagcgcatagccgcggagcgagag
gcggcaacgagggaggcggaggcggccgggaaagggggtggcgggaagcag

DBGET integrated database retrieval system