KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_168483Help
Entry
CHLREDRAFT_168483 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00010  Glycolysis / Gluconeogenesis
cre00562  Inositol phosphate metabolism
cre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_168483
   00562 Inositol phosphate metabolism
    CHLREDRAFT_168483
Enzymes [BR:cre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     CHLREDRAFT_168483
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     CHLREDRAFT_168483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase His_Phos_2 Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 5719094
NCBI-ProteinID: XP_001693709
JGI: 168483
UniProt: A8HS46
Position
Unknown
AA seq 733 aa AA seqDB search
MSPARALLIAVLMALAAMLSRGAGVFDVRRHLGTKTRYAYRLAVPGAPSIYKQPDPEGYE
PVHLWLMARHGTRQDSRNTADHPWLSNWTAPFPDVGFLGGELHPIGADELWGLAYRLRKR
FPSLAGLEYLPKRFPVVARTAASASAFTAGFFPEVGAADAAGGLLSAADELDASLREVPA
VKRPQAVAMSMAPKAADPLLRFFDVCPAYAQHDEYTEKWMGGWMQGNWSALVPALEKRLG
LSRDMDPCEVEALWQLCLLEAGLEGVGNRACSLFTPQEAMQLEWVDDIHLLETQSWGADI
NYRIAAPLLRDAALLLFAHCETLVPLATLMGLFRPPAPQPPDASAAAINAAVSAAAAQRH
LLQVDTLEDLSMLVNDLHRLNDQDARKAATGGKARAKGRLGSEDSHSCYPGRAPVDPDAV
PPPEGWYPMFPNDDSRLFKGSRLAPYAANMALVLPVPGCGAAGSGSDCDLDEFLELMEGK
MDADALDRLCGPAATAARAAAATGGLRGDGGASLMFDRKGVPSKTPPRRDTADLGKRVEG
DLAAQTTLANLDLRRLGTFQDDHYLYLLLEYCPGGDLDRLVRAHTRKTLVPRSTWIAQAA
VRFYAAGLVIALQVVKIECEALAREGRGVVAGGLLDNCRRLAEEEDKLNNKNNNDNAKAW
WSLGAVLYVLLTGTKPFCSPEAEAAGEDAARLLMRIIDPWYEPPLPVYLSPAARDLLCGS
TCSNAAAATCRLQ
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgcacgcgcgctactaatcgcagtgcttatggcgttggctgcgatgctatcg
cgaggcgcgggcgtcttcgacgtgcggcgacatctcggcaccaagacgcgatatgcgtat
cggctagcagtgcccggtgctcccagcatctacaagcaaccggacccggagggctatgag
cccgtccacctctggcttatggcccgccatggcacgcggcaagactcgcgcaatactgcc
gaccacccctggctgagcaactggacggcgcccttcccggacgtgggcttcctgggcgga
gagctgcaccccattggcgcggacgagctgtggggcctggcctaccggctgcgcaagcgc
ttcccctccctggccggactggagtacctgcccaagcgcttccccgtggtggcgcgcacc
gccgccagtgcctcggccttcaccgccggcttcttccccgaggtgggggctgctgatgcc
gccggggggctgctgtcggcggcggacgagctggatgccagtctgcgcgaggtgccggct
gtgaagcggccgcaggctgtggccatgtccatggcgcccaaggccgccgacccgctgctg
cgcttcttcgacgtgtgccccgcctacgcccaacacgacgagtacaccgagaagtggatg
ggcggctggatgcagggcaactggtcggcattggtgccggcgctggagaagcggctgggc
ctgtcccgggacatggacccgtgcgaggttgaggctctgtggcagctgtgtctgctggag
gccggtctggagggcgtgggcaacagggcctgcagcctgttcacgccgcaggaggcgatg
cagctggagtgggtggacgacatccacctactggagacgcagtcctggggcgccgacatc
aactaccgcatcgccgcgccgctgctgcgagacgccgcgctgctgctgttcgcgcactgc
gagacgctggtgccgctggccactttgatgggcctgttcaggccgcccgcgccacagccg
ccggacgcctccgccgccgccatcaacgcggcggtgtcggcggcggcggcacagcggcac
ctgctgcaggttgacacgctggaggacctcagcatgctcgtcaacgacctgcaccgcctg
aacgaccaggacgcgcgcaaggccgccacgggcggcaaggccagagccaagggccgcctg
ggcagcgaggacagccactcctgctacccggggcgggcgcccgtggacccggatgccgtg
ccgccgccggagggctggtaccccatgttccccaacgacgactcgcggctgttcaagggc
tcgcgcctggcgccctacgcagccaacatggcgctggtcctgcccgtgcccggctgcggc
gcggcgggatctggatccgactgcgacctggacgagttcctggagctcatggagggcaag
atggacgcagacgcactggaccgactgtgtggcccagctgccacagccgccagggcggcg
gcggcgacggggggcctgcgtggcgacggcggcgcgtcgctcatgtttgaccgcaagggc
gtgccgtccaagacgccgccgcggcgcgacacggccgacctgggcaagcgagtggaaggc
gacctcgcggctcagaccaccctcgcgaacttggacctgcgtcgcctggggactttccag
gacgaccactacctgtacctgctgctggagtactgccccggcggcgacctggaccgcctg
gtgcgggcacacacgcgcaagacgctggtgccgcggagcacctggattgcgcaggcggcc
gtgcgcttctacgccgccggactggtcattgcgctgcaggtggtgaagatcgagtgtgag
gcgctggctcgcgagggccgcggcgtggtggcgggcgggttgctggacaactgccgccgc
ctcgccgaggaggaggacaaactcaacaacaagaacaacaacgacaacgcgaaggcttgg
tggtctctgggcgcggtgctctatgtgctgctgaccggcaccaagcccttctgcagcccc
gaggccgaggcggcgggcgaggacgctgcccggctgctgatgcgcatcatcgacccctgg
tacgagccgccgctgcccgtgtacctcagtccggccgcacgtgacctgctatgcggtagt
acctgcagcaatgcagcagcagcaacctgcaggctgcagtag

DBGET integrated database retrieval system