KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_174824Help
Entry
CHLREDRAFT_174824 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
cre  Chlamydomonas reinhardtii
Brite
KEGG Orthology (KO) [BR:cre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cre03019]
    CHLREDRAFT_174824
Enzymes [BR:cre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     CHLREDRAFT_174824
Messenger RNA biogenesis [BR:cre03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     CHLREDRAFT_174824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 5721047
NCBI-ProteinID: XP_001695378
JGI: 174824
UniProt: A8J2E1
Position
Unknown
AA seq 331 aa AA seqDB search
MATLPGAAAAAPGANAEVGVPEPSLEPQDALQQRIALAEGLLALNEADAMQAWQQLPREA
LLEQVAKYRGAVRDMASALRSSTLPGGVPPHCVPIHANVTTFDWPSLYSHAQFDVIMMDP
PWQLATANPTRGVALGYSQLNDDHISRLPVPQLQRQGGYLFVWVINAKYKWTLDLFDRWG
YRLVDEVVWVKMTVNRRLAKSHGYYLQHAKEVCLVAKRGNPPVPPGCEGGVGSDIIFSER
RGQSQKPEEIYHLIEQLVPNGRYLEIFARKNNLRNYWVSIGNEVTGTGLPDEDMQALRDL
HHIPGAVYGKNAPHLVSKLFLYAPNSSREEG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcaacattgcccggcgcggcagccgctgcgccgggcgcgaatgctgaagtgggcgtg
cctgaaccaagcttggagccgcaggatgcactccagcaacgcatcgccctggcagaggga
cttcttgctcttaatgaggcggatgcaatgcaagcctggcagcagctgccgcgtgaggcg
ctgctggagcaggtcgccaagtaccggggtgctgtgcgcgacatggcgtcggcgcttcgc
tcctccactctcccgggcggggtgccgccgcactgcgtgcccatccacgccaacgtgacc
acctttgactggccctcgctctacagccacgcccagttcgacgtcatcatgatggacccg
ccgtggcagcttgctacagccaaccccacgcgcggcgtggcgctgggctacagccagctg
aacgacgaccacatcagccggctgccggtgccgcagctgcagcggcagggcggctacttg
ttcgtgtgggtcatcaacgccaagtacaagtggaccctggacctgttcgacagatgggga
tacaggctggtggacgaggtggtgtgggtcaagatgacggtcaaccggcgactggccaag
agccacggctactacctgcagcacgccaaggaggtgtgcctggtagccaagcgcggcaac
ccgcctgtgccccccgggtgcgagggcggcgtgggcagtgacatcatcttcagcgagcgc
cgcggccagagccagaagcccgaggagatctaccacctcatcgagcagctggtgccaaac
ggccgctacctggagatattcgcgcgcaagaacaacctgcgcaactactgggtgtccatc
ggcaacgaggtcacaggcaccgggctgcctgacgaggacatgcaggcgctgcgtgatctt
caccacatccccggcgccgtgtacggcaagaacgcgccccaccttgtgtccaagctattt
ttgtatgcacccaattcaagccgcgaggagggctag

DBGET integrated database retrieval system